Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1PEV3

Protein Details
Accession N1PEV3    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-36SISSKRGRGRGPKMEKRPSPBasic
NLS Segment(s)
PositionSequence
21-33KRGRGRGPKMEKR
Subcellular Location(s) nucl 15, cyto_nucl 11.5, cyto 6, plas 3
Family & Domain DBs
Amino Acid Sequences MCGKVNDVEFELSLLDSISSKRGRGRGPKMEKRPSPLCEYERALTSSLNSATHLSFFGAAGYTLSSDGSITAYFAVLDDVTDYTSEMCYTKFIDPIELLLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.06
4 0.07
5 0.12
6 0.13
7 0.15
8 0.19
9 0.24
10 0.31
11 0.4
12 0.49
13 0.54
14 0.63
15 0.72
16 0.77
17 0.82
18 0.78
19 0.76
20 0.73
21 0.66
22 0.62
23 0.58
24 0.51
25 0.46
26 0.46
27 0.39
28 0.35
29 0.32
30 0.26
31 0.2
32 0.18
33 0.16
34 0.13
35 0.12
36 0.1
37 0.1
38 0.09
39 0.1
40 0.09
41 0.07
42 0.07
43 0.06
44 0.06
45 0.05
46 0.05
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.04
64 0.04
65 0.05
66 0.05
67 0.06
68 0.06
69 0.06
70 0.06
71 0.07
72 0.08
73 0.07
74 0.07
75 0.09
76 0.12
77 0.14
78 0.17
79 0.17
80 0.2
81 0.19