Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2WJV4

Protein Details
Accession M2WJV4    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
152-174EEENKRRPGKPSFQKKNPNGGDVHydrophilic
NLS Segment(s)
PositionSequence
78-107REKPVPKEKEKTKWEKFAEKKGIKGKRKDG
147-187RKKADEEENKRRPGKPSFQKKNPNGGDVERRDRKLKARKGK
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MADSKAQPYVFDLGHMLVTDSNPIPSYNDSTRETTLTTTARDCAEALINQLLTACPISKADDGAFQITLPAPETHLPREKPVPKEKEKTKWEKFAEKKGIKGKRKDGKLQYDEAKGDWVPKYGYKGKSATGGVEADWIMEVDEKAERKKADEEENKRRPGKPSFQKKNPNGGDVERRDRKLKARKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.13
4 0.1
5 0.1
6 0.13
7 0.12
8 0.12
9 0.12
10 0.13
11 0.14
12 0.16
13 0.22
14 0.22
15 0.27
16 0.29
17 0.32
18 0.33
19 0.32
20 0.3
21 0.25
22 0.26
23 0.23
24 0.22
25 0.19
26 0.2
27 0.19
28 0.19
29 0.17
30 0.14
31 0.15
32 0.13
33 0.14
34 0.14
35 0.13
36 0.12
37 0.13
38 0.11
39 0.09
40 0.09
41 0.07
42 0.06
43 0.07
44 0.1
45 0.1
46 0.12
47 0.11
48 0.14
49 0.14
50 0.15
51 0.14
52 0.11
53 0.11
54 0.1
55 0.1
56 0.09
57 0.08
58 0.08
59 0.11
60 0.13
61 0.17
62 0.23
63 0.23
64 0.24
65 0.33
66 0.37
67 0.41
68 0.49
69 0.53
70 0.54
71 0.62
72 0.65
73 0.67
74 0.69
75 0.73
76 0.69
77 0.7
78 0.67
79 0.68
80 0.65
81 0.65
82 0.67
83 0.58
84 0.58
85 0.58
86 0.63
87 0.61
88 0.63
89 0.64
90 0.61
91 0.65
92 0.68
93 0.68
94 0.68
95 0.65
96 0.63
97 0.58
98 0.53
99 0.48
100 0.4
101 0.34
102 0.24
103 0.23
104 0.18
105 0.16
106 0.13
107 0.14
108 0.2
109 0.25
110 0.28
111 0.29
112 0.3
113 0.29
114 0.33
115 0.32
116 0.27
117 0.22
118 0.2
119 0.16
120 0.16
121 0.14
122 0.09
123 0.09
124 0.08
125 0.06
126 0.06
127 0.06
128 0.06
129 0.09
130 0.11
131 0.12
132 0.17
133 0.17
134 0.2
135 0.26
136 0.3
137 0.37
138 0.46
139 0.54
140 0.61
141 0.69
142 0.74
143 0.73
144 0.71
145 0.67
146 0.66
147 0.67
148 0.67
149 0.69
150 0.72
151 0.78
152 0.86
153 0.86
154 0.88
155 0.81
156 0.75
157 0.67
158 0.63
159 0.63
160 0.6
161 0.63
162 0.6
163 0.6
164 0.61
165 0.62
166 0.65
167 0.66