Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1Q4J4

Protein Details
Accession N1Q4J4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-47MKVGKPKSKRVPVRLRHKIQKASANKQRKERKDAKKNPQWRSRLKKDBasic
NLS Segment(s)
PositionSequence
4-46GKPKSKRVPVRLRHKIQKASANKQRKERKDAKKNPQWRSRLKK
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR014813  Gnl3_N_dom  
Pfam View protein in Pfam  
PF08701  GN3L_Grn1  
Amino Acid Sequences MKVGKPKSKRVPVRLRHKIQKASANKQRKERKDAKKNPQWRSRLKKDPGVPNLFPYKDKVLAEIEESKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.88
4 0.86
5 0.83
6 0.78
7 0.78
8 0.75
9 0.74
10 0.75
11 0.75
12 0.71
13 0.74
14 0.77
15 0.74
16 0.75
17 0.75
18 0.77
19 0.78
20 0.83
21 0.84
22 0.84
23 0.87
24 0.87
25 0.85
26 0.82
27 0.81
28 0.8
29 0.79
30 0.8
31 0.76
32 0.75
33 0.74
34 0.76
35 0.75
36 0.72
37 0.64
38 0.58
39 0.6
40 0.53
41 0.47
42 0.41
43 0.37
44 0.34
45 0.34
46 0.31
47 0.28
48 0.27
49 0.31