Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1Q160

Protein Details
Accession N1Q160   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-35MGRELQKKKNRSGINKVRQKPKSKKKILTNPIIAEHydrophilic
NLS Segment(s)
PositionSequence
7-26KKKNRSGINKVRQKPKSKKK
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019002  Ribosome_biogenesis_Nop16  
Gene Ontology GO:0005730  C:nucleolus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0042273  P:ribosomal large subunit biogenesis  
Pfam View protein in Pfam  
PF09420  Nop16  
Amino Acid Sequences MGRELQKKKNRSGINKVRQKPKSKKKILTNPIIAENWDKSQSLAQNYRRLGLTAKLNKNTGGIERKVSDVLNETARRGDALHIANASKRKEVLDVTEAKIERDPETGEILRVLDGGTTTVRANPLNDPLNDLDSDDSEDQVLNHRNQHATDGFGGAADDNAESKTETVRRLEEEANRPAKKFKRQMPDGEMEFVEELVRKYGADYGKMTRDHKINYMQRSEGDLKKRIKKWMENGGTVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.86
3 0.86
4 0.87
5 0.87
6 0.88
7 0.88
8 0.88
9 0.88
10 0.88
11 0.89
12 0.9
13 0.92
14 0.91
15 0.9
16 0.87
17 0.79
18 0.74
19 0.65
20 0.55
21 0.48
22 0.41
23 0.33
24 0.27
25 0.24
26 0.19
27 0.23
28 0.26
29 0.3
30 0.36
31 0.39
32 0.45
33 0.46
34 0.47
35 0.43
36 0.4
37 0.34
38 0.3
39 0.34
40 0.36
41 0.43
42 0.44
43 0.45
44 0.44
45 0.43
46 0.4
47 0.36
48 0.33
49 0.27
50 0.27
51 0.27
52 0.28
53 0.28
54 0.26
55 0.21
56 0.18
57 0.19
58 0.22
59 0.22
60 0.21
61 0.21
62 0.21
63 0.2
64 0.17
65 0.16
66 0.14
67 0.15
68 0.16
69 0.16
70 0.16
71 0.19
72 0.23
73 0.23
74 0.18
75 0.18
76 0.17
77 0.18
78 0.18
79 0.19
80 0.2
81 0.22
82 0.22
83 0.26
84 0.25
85 0.24
86 0.25
87 0.22
88 0.18
89 0.16
90 0.15
91 0.11
92 0.15
93 0.15
94 0.13
95 0.12
96 0.11
97 0.1
98 0.09
99 0.08
100 0.04
101 0.04
102 0.04
103 0.04
104 0.05
105 0.05
106 0.06
107 0.07
108 0.07
109 0.09
110 0.09
111 0.14
112 0.16
113 0.16
114 0.18
115 0.17
116 0.18
117 0.17
118 0.16
119 0.12
120 0.09
121 0.12
122 0.09
123 0.09
124 0.08
125 0.08
126 0.07
127 0.12
128 0.15
129 0.14
130 0.17
131 0.19
132 0.19
133 0.2
134 0.23
135 0.19
136 0.17
137 0.16
138 0.14
139 0.12
140 0.11
141 0.11
142 0.07
143 0.06
144 0.05
145 0.04
146 0.04
147 0.04
148 0.05
149 0.05
150 0.06
151 0.09
152 0.12
153 0.14
154 0.16
155 0.18
156 0.2
157 0.24
158 0.28
159 0.32
160 0.35
161 0.41
162 0.48
163 0.47
164 0.46
165 0.5
166 0.52
167 0.55
168 0.58
169 0.58
170 0.6
171 0.65
172 0.72
173 0.71
174 0.72
175 0.64
176 0.58
177 0.49
178 0.4
179 0.34
180 0.25
181 0.19
182 0.13
183 0.11
184 0.1
185 0.1
186 0.09
187 0.09
188 0.15
189 0.16
190 0.18
191 0.2
192 0.24
193 0.3
194 0.35
195 0.36
196 0.37
197 0.4
198 0.4
199 0.43
200 0.48
201 0.49
202 0.52
203 0.56
204 0.52
205 0.47
206 0.52
207 0.52
208 0.49
209 0.49
210 0.5
211 0.54
212 0.62
213 0.66
214 0.68
215 0.71
216 0.73
217 0.75
218 0.78
219 0.76