Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1PX80

Protein Details
Accession N1PX80    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGGKKQKKKWSKGKVKDKANHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 14, mito 8, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGGKKQKKKWSKGKVKDKANHAVVLDKNTGEKLQKDVQSYRLITVAVLVDRLKINGSLARKALNDLEEKGVIKQVIGHSACKVYTRAVGGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.88
9 0.85
10 0.83
11 0.74
12 0.66
13 0.55
14 0.52
15 0.43
16 0.39
17 0.33
18 0.24
19 0.21
20 0.19
21 0.2
22 0.16
23 0.15
24 0.16
25 0.2
26 0.24
27 0.27
28 0.28
29 0.3
30 0.33
31 0.33
32 0.28
33 0.23
34 0.2
35 0.16
36 0.15
37 0.12
38 0.07
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.1
48 0.13
49 0.14
50 0.15
51 0.17
52 0.17
53 0.19
54 0.2
55 0.19
56 0.19
57 0.18
58 0.2
59 0.19
60 0.2
61 0.19
62 0.2
63 0.17
64 0.15
65 0.16
66 0.15
67 0.22
68 0.23
69 0.24
70 0.22
71 0.25
72 0.25
73 0.24
74 0.24
75 0.18
76 0.2
77 0.22