Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1Q4C5

Protein Details
Accession N1Q4C5    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
118-137RFMGKERKRHVPPPAKPPEGBasic
NLS Segment(s)
PositionSequence
122-131KERKRHVPPP
Subcellular Location(s) mito 10, nucl 9, cyto 3, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPNRCYSSTKPAPPSPRPYQQTAPEQRSSRRPQCPDTPAAVEQKKSLISRVWPFKLSQQGPIDIGIRDPARGVEAARRVAKGGVLDSRYKPTASRVTALIVALPISIYLSYELIQRRFMGKERKRHVPPPAKPPEGSMNPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.75
3 0.73
4 0.74
5 0.7
6 0.69
7 0.68
8 0.67
9 0.69
10 0.7
11 0.68
12 0.65
13 0.64
14 0.63
15 0.65
16 0.67
17 0.65
18 0.65
19 0.64
20 0.63
21 0.68
22 0.69
23 0.64
24 0.58
25 0.53
26 0.47
27 0.5
28 0.46
29 0.38
30 0.33
31 0.31
32 0.3
33 0.26
34 0.24
35 0.19
36 0.21
37 0.28
38 0.35
39 0.36
40 0.33
41 0.34
42 0.36
43 0.43
44 0.38
45 0.38
46 0.32
47 0.31
48 0.3
49 0.3
50 0.27
51 0.18
52 0.17
53 0.13
54 0.11
55 0.09
56 0.09
57 0.08
58 0.07
59 0.08
60 0.08
61 0.1
62 0.12
63 0.16
64 0.17
65 0.17
66 0.17
67 0.17
68 0.18
69 0.14
70 0.13
71 0.13
72 0.14
73 0.16
74 0.17
75 0.21
76 0.21
77 0.21
78 0.2
79 0.22
80 0.27
81 0.26
82 0.26
83 0.24
84 0.24
85 0.25
86 0.25
87 0.19
88 0.12
89 0.1
90 0.08
91 0.07
92 0.05
93 0.04
94 0.04
95 0.04
96 0.05
97 0.06
98 0.06
99 0.11
100 0.15
101 0.16
102 0.18
103 0.18
104 0.21
105 0.23
106 0.3
107 0.37
108 0.4
109 0.49
110 0.54
111 0.64
112 0.68
113 0.73
114 0.77
115 0.76
116 0.77
117 0.77
118 0.81
119 0.76
120 0.69
121 0.66
122 0.65