Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1Q4A5

Protein Details
Accession N1Q4A5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
75-96MIRSNRKKALKAKQKAQAQKAQHydrophilic
NLS Segment(s)
PositionSequence
80-89RKKALKAKQK
Subcellular Location(s) plas 19, E.R. 5, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MAANSLLDRIVGLAMLILASTVFLYYTTWTLLMPFVDSGHPIQTLFPPRVWAIRIPVILLLLGGAVVGSFLSVVMIRSNRKKALKAKQKAQAQKAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.03
5 0.02
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.04
12 0.05
13 0.06
14 0.07
15 0.07
16 0.07
17 0.07
18 0.08
19 0.08
20 0.07
21 0.07
22 0.07
23 0.07
24 0.08
25 0.08
26 0.09
27 0.09
28 0.08
29 0.08
30 0.11
31 0.15
32 0.15
33 0.14
34 0.15
35 0.15
36 0.17
37 0.17
38 0.15
39 0.14
40 0.17
41 0.17
42 0.15
43 0.15
44 0.14
45 0.12
46 0.11
47 0.07
48 0.03
49 0.03
50 0.03
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.03
60 0.04
61 0.07
62 0.1
63 0.16
64 0.23
65 0.29
66 0.36
67 0.4
68 0.48
69 0.55
70 0.63
71 0.69
72 0.72
73 0.75
74 0.77
75 0.83
76 0.84