Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0CS76

Protein Details
Accession B0CS76   
Localization Confidence High
Confidence Score 23
NoLS Segment(s)
PositionSequenceProtein Nature
33-55SAPTPAKRGRGRPKGSRNKKSLTHydrophilic
60-105ASAPTTPRKRGRPPKEKKEEDGDEPVAKRPRGRPPKNPKPPTKDGEBasic
112-133SGDPESSTKKKRGRPPKNAAATHydrophilic
NLS Segment(s)
PositionSequence
37-129PAKRGRGRPKGSRNKKSLTGAADASAPTTPRKRGRPPKEKKEEDGDEPVAKRPRGRPPKNPKPPTKDGEASGAGGSGDPESSTKKKRGRPPKN
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
KEGG lbc:LACBIDRAFT_292223  -  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSTSPRDAQDEGADKLDELEEPQPTGDAEAGTSAPTPAKRGRGRPKGSRNKKSLTGAADASAPTTPRKRGRPPKEKKEEDGDEPVAKRPRGRPPKNPKPPTKDGEASGAGGSGDPESSTKKKRGRPPKNAAAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.22
4 0.15
5 0.13
6 0.13
7 0.12
8 0.12
9 0.12
10 0.12
11 0.12
12 0.12
13 0.1
14 0.08
15 0.07
16 0.07
17 0.07
18 0.07
19 0.07
20 0.07
21 0.08
22 0.09
23 0.12
24 0.15
25 0.24
26 0.29
27 0.38
28 0.49
29 0.57
30 0.64
31 0.71
32 0.79
33 0.81
34 0.87
35 0.86
36 0.82
37 0.76
38 0.74
39 0.68
40 0.61
41 0.53
42 0.45
43 0.36
44 0.3
45 0.26
46 0.2
47 0.16
48 0.12
49 0.1
50 0.09
51 0.11
52 0.16
53 0.21
54 0.28
55 0.37
56 0.48
57 0.58
58 0.67
59 0.75
60 0.81
61 0.86
62 0.84
63 0.77
64 0.75
65 0.68
66 0.61
67 0.56
68 0.48
69 0.4
70 0.37
71 0.39
72 0.35
73 0.32
74 0.31
75 0.32
76 0.4
77 0.49
78 0.56
79 0.61
80 0.67
81 0.78
82 0.85
83 0.89
84 0.88
85 0.86
86 0.86
87 0.8
88 0.76
89 0.69
90 0.59
91 0.55
92 0.46
93 0.38
94 0.3
95 0.26
96 0.18
97 0.14
98 0.13
99 0.07
100 0.06
101 0.05
102 0.07
103 0.13
104 0.19
105 0.25
106 0.33
107 0.41
108 0.5
109 0.6
110 0.7
111 0.76
112 0.81
113 0.86