Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2WMD8

Protein Details
Accession M2WMD8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
45-71TSSTRNDGTPRKKRRYKPGTKALKEIRHydrophilic
NLS Segment(s)
PositionSequence
16-68PGTPRTPLGAGRGGRGGKGGRGSRGGRKSTSSTRNDGTPRKKRRYKPGTKALK
Subcellular Location(s) nucl 15, mito 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000164  Histone_H3/CENP-A  
Gene Ontology GO:0005729  C:2-micrometer circle DNA  
GO:0043505  C:CENP-A containing nucleosome  
GO:0000779  C:condensed chromosome, centromeric region  
GO:0005634  C:nucleus  
GO:0019237  F:centromeric DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
GO:0030543  P:2-micrometer plasmid partitioning  
GO:0051382  P:kinetochore assembly  
GO:0000070  P:mitotic sister chromatid segregation  
GO:0061644  P:protein localization to CENP-A containing chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00959  HISTONE_H3_2  
Amino Acid Sequences MAKTTGRPSLGGKSAPGTPRTPLGAGRGGRGGKGGRGSRGGRKSTSSTRNDGTPRKKRRYKPGTKALKEIRHYQKSTDLLLLKLPFSRLVREISLNMAPVSAGVTRWQSQAIQALQEAAEAFLIHLFEDSNLCAIHAKRVTIMQKDIQLARRIRGAWGGLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.36
4 0.3
5 0.28
6 0.3
7 0.31
8 0.3
9 0.26
10 0.26
11 0.29
12 0.28
13 0.28
14 0.3
15 0.28
16 0.26
17 0.28
18 0.24
19 0.2
20 0.26
21 0.27
22 0.24
23 0.3
24 0.33
25 0.39
26 0.45
27 0.46
28 0.41
29 0.42
30 0.46
31 0.48
32 0.54
33 0.5
34 0.47
35 0.45
36 0.49
37 0.51
38 0.54
39 0.56
40 0.57
41 0.63
42 0.69
43 0.76
44 0.78
45 0.83
46 0.85
47 0.86
48 0.86
49 0.86
50 0.87
51 0.8
52 0.81
53 0.78
54 0.74
55 0.66
56 0.65
57 0.64
58 0.61
59 0.59
60 0.51
61 0.5
62 0.44
63 0.43
64 0.37
65 0.28
66 0.21
67 0.22
68 0.21
69 0.15
70 0.14
71 0.13
72 0.12
73 0.12
74 0.14
75 0.13
76 0.15
77 0.16
78 0.17
79 0.17
80 0.16
81 0.16
82 0.15
83 0.13
84 0.11
85 0.09
86 0.08
87 0.09
88 0.06
89 0.05
90 0.06
91 0.09
92 0.1
93 0.11
94 0.12
95 0.11
96 0.12
97 0.18
98 0.17
99 0.15
100 0.14
101 0.14
102 0.13
103 0.14
104 0.12
105 0.07
106 0.06
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.06
116 0.07
117 0.07
118 0.07
119 0.08
120 0.11
121 0.11
122 0.18
123 0.2
124 0.2
125 0.2
126 0.27
127 0.32
128 0.34
129 0.38
130 0.34
131 0.37
132 0.41
133 0.45
134 0.44
135 0.47
136 0.45
137 0.43
138 0.44
139 0.4
140 0.37
141 0.37