Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1Q0C9

Protein Details
Accession N1Q0C9    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
67-88RTASHNAKRVPKRLQPRAKREVHydrophilic
NLS Segment(s)
PositionSequence
49-87KKALTKRAFQQVPKDMRRRTASHNAKRVPKRLQPRAKRE
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039182  Pop1  
IPR009723  Pop1_N  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0001682  P:tRNA 5'-leader removal  
Pfam View protein in Pfam  
PF06978  POP1  
Amino Acid Sequences QRAKQRNARTLQTQTASKALKNGELDVDKFVKSREYEIRALEEGMARSKKALTKRAFQQVPKDMRRRTASHNAKRVPKRLQPRAKREV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.49
3 0.44
4 0.37
5 0.35
6 0.29
7 0.29
8 0.28
9 0.26
10 0.24
11 0.24
12 0.25
13 0.23
14 0.24
15 0.19
16 0.18
17 0.18
18 0.17
19 0.16
20 0.2
21 0.22
22 0.26
23 0.28
24 0.29
25 0.31
26 0.27
27 0.27
28 0.23
29 0.17
30 0.13
31 0.14
32 0.14
33 0.11
34 0.11
35 0.12
36 0.15
37 0.2
38 0.28
39 0.28
40 0.35
41 0.42
42 0.51
43 0.54
44 0.53
45 0.56
46 0.56
47 0.62
48 0.63
49 0.64
50 0.57
51 0.6
52 0.63
53 0.59
54 0.58
55 0.6
56 0.63
57 0.65
58 0.72
59 0.72
60 0.76
61 0.8
62 0.79
63 0.77
64 0.75
65 0.77
66 0.78
67 0.82
68 0.83