Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2WLN3

Protein Details
Accession M2WLN3    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
146-171GDSPTKKPKAAPRKKATPKKAKAAEEBasic
NLS Segment(s)
PositionSequence
85-106APAKPTAAPAKPAATPKKRGKK
127-137KKVKSTPRKNK
149-168PTKKPKAAPRKKATPKKAKA
Subcellular Location(s) nucl 13.5, cyto_nucl 12.5, cyto 8.5, mito 4
Family & Domain DBs
Amino Acid Sequences MSADAAVKATTPDEAPQLSEKHQKLLIAGVLSSKGGLPDVDYDRLTKLGGFNTKKTAQNQWGELKKVLKSINPEAYEAAAATKPAPAKPTAAPAKPAATPKKRGKKESDGEEATEVQAGEEAPPSAKKVKSTPRKNKADVDAADGGDSPTKKPKAAPRKKATPKKAKAAEEGPEEAAATKSNDEGEKVAEESKDETEKAAKTQSEDEKTKDIEKTPIAVTESDADTEMEGASDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.2
4 0.23
5 0.26
6 0.35
7 0.34
8 0.35
9 0.36
10 0.35
11 0.31
12 0.32
13 0.3
14 0.21
15 0.2
16 0.17
17 0.16
18 0.15
19 0.14
20 0.11
21 0.08
22 0.08
23 0.07
24 0.07
25 0.12
26 0.16
27 0.19
28 0.19
29 0.2
30 0.2
31 0.21
32 0.2
33 0.15
34 0.14
35 0.17
36 0.25
37 0.28
38 0.29
39 0.35
40 0.4
41 0.44
42 0.45
43 0.47
44 0.46
45 0.47
46 0.5
47 0.52
48 0.52
49 0.5
50 0.5
51 0.45
52 0.39
53 0.39
54 0.36
55 0.3
56 0.31
57 0.35
58 0.4
59 0.37
60 0.37
61 0.32
62 0.31
63 0.28
64 0.22
65 0.16
66 0.09
67 0.08
68 0.07
69 0.09
70 0.09
71 0.1
72 0.12
73 0.11
74 0.14
75 0.15
76 0.23
77 0.27
78 0.27
79 0.28
80 0.28
81 0.29
82 0.29
83 0.35
84 0.35
85 0.34
86 0.42
87 0.5
88 0.58
89 0.62
90 0.65
91 0.66
92 0.68
93 0.69
94 0.67
95 0.65
96 0.56
97 0.51
98 0.46
99 0.39
100 0.29
101 0.23
102 0.15
103 0.08
104 0.07
105 0.06
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.07
112 0.11
113 0.11
114 0.13
115 0.19
116 0.29
117 0.4
118 0.51
119 0.6
120 0.67
121 0.74
122 0.76
123 0.75
124 0.7
125 0.67
126 0.57
127 0.51
128 0.43
129 0.35
130 0.31
131 0.25
132 0.21
133 0.15
134 0.15
135 0.1
136 0.16
137 0.17
138 0.18
139 0.22
140 0.32
141 0.41
142 0.52
143 0.61
144 0.63
145 0.73
146 0.83
147 0.89
148 0.89
149 0.89
150 0.86
151 0.85
152 0.84
153 0.77
154 0.72
155 0.67
156 0.61
157 0.54
158 0.49
159 0.39
160 0.31
161 0.27
162 0.22
163 0.18
164 0.13
165 0.1
166 0.09
167 0.09
168 0.11
169 0.11
170 0.12
171 0.12
172 0.12
173 0.13
174 0.13
175 0.15
176 0.13
177 0.14
178 0.15
179 0.18
180 0.18
181 0.17
182 0.17
183 0.2
184 0.21
185 0.23
186 0.26
187 0.24
188 0.25
189 0.33
190 0.4
191 0.43
192 0.45
193 0.46
194 0.46
195 0.47
196 0.49
197 0.45
198 0.39
199 0.37
200 0.36
201 0.36
202 0.32
203 0.33
204 0.31
205 0.27
206 0.26
207 0.24
208 0.23
209 0.2
210 0.19
211 0.16
212 0.14
213 0.14
214 0.12