Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1Q3D0

Protein Details
Accession N1Q3D0   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
99-126PEEAKLVTEKQKKKQRHFPLRNYAVKAAHydrophilic
NLS Segment(s)
PositionSequence
88-114KQTRAIRRRLSPEEAKLVTEKQKKKQR
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSGKVKAAQLWGKNKEELKTQLAELKQELVQLRTQKIAGGAQSKLNKIHDVRKSIARVLTIINANQRSQLRLFYKGKKYTPLDLRPKQTRAIRRRLSPEEAKLVTEKQKKKQRHFPLRNYAVKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.56
3 0.5
4 0.5
5 0.47
6 0.42
7 0.38
8 0.36
9 0.36
10 0.34
11 0.33
12 0.27
13 0.25
14 0.21
15 0.22
16 0.22
17 0.18
18 0.22
19 0.24
20 0.24
21 0.23
22 0.23
23 0.2
24 0.2
25 0.2
26 0.19
27 0.18
28 0.17
29 0.21
30 0.24
31 0.25
32 0.26
33 0.25
34 0.26
35 0.26
36 0.33
37 0.33
38 0.34
39 0.35
40 0.39
41 0.39
42 0.37
43 0.36
44 0.28
45 0.24
46 0.2
47 0.2
48 0.15
49 0.14
50 0.16
51 0.16
52 0.15
53 0.19
54 0.18
55 0.17
56 0.17
57 0.22
58 0.2
59 0.27
60 0.32
61 0.36
62 0.45
63 0.49
64 0.5
65 0.52
66 0.53
67 0.53
68 0.58
69 0.59
70 0.61
71 0.61
72 0.67
73 0.66
74 0.65
75 0.64
76 0.62
77 0.63
78 0.61
79 0.66
80 0.64
81 0.65
82 0.71
83 0.7
84 0.71
85 0.67
86 0.64
87 0.61
88 0.55
89 0.49
90 0.43
91 0.41
92 0.43
93 0.46
94 0.48
95 0.5
96 0.59
97 0.67
98 0.75
99 0.81
100 0.83
101 0.86
102 0.89
103 0.9
104 0.91
105 0.91
106 0.89