Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1PIH5

Protein Details
Accession N1PIH5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
11-37LLGSSGRCRRRSRSRRRSRSRSVWAAAHydrophilic
NLS Segment(s)
PositionSequence
16-31GRCRRRSRSRRRSRSR
Subcellular Location(s) mito 10, cyto 10, cyto_mito 10
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQEERKKVRVLLGSSGRCRRRSRSRRRSRSRSVWAAAVCVVGRPLLVWRHYFLGTRRWLSGGVARAWKRARSGGECHVNRARTTALIPTFIGIVGEIVPDHGADRRRRSTC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.65
3 0.64
4 0.63
5 0.64
6 0.64
7 0.66
8 0.7
9 0.75
10 0.77
11 0.83
12 0.88
13 0.94
14 0.95
15 0.93
16 0.93
17 0.91
18 0.87
19 0.78
20 0.72
21 0.61
22 0.52
23 0.42
24 0.33
25 0.23
26 0.15
27 0.12
28 0.07
29 0.06
30 0.05
31 0.07
32 0.09
33 0.11
34 0.12
35 0.13
36 0.16
37 0.17
38 0.19
39 0.18
40 0.22
41 0.24
42 0.24
43 0.23
44 0.22
45 0.21
46 0.2
47 0.22
48 0.18
49 0.17
50 0.22
51 0.22
52 0.26
53 0.28
54 0.29
55 0.27
56 0.28
57 0.3
58 0.28
59 0.33
60 0.36
61 0.44
62 0.43
63 0.47
64 0.48
65 0.45
66 0.41
67 0.38
68 0.31
69 0.22
70 0.23
71 0.23
72 0.19
73 0.19
74 0.19
75 0.17
76 0.16
77 0.15
78 0.14
79 0.07
80 0.07
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.06
88 0.1
89 0.17
90 0.24
91 0.33