Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

N1PE42

Protein Details
Accession N1PE42   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
58-88DGPASAKKPKKVKEKQKERRAKRKEALAKSSBasic
NLS Segment(s)
PositionSequence
60-83PASAKKPKKVKEKQKERRAKRKEA
Subcellular Location(s) mito 15.5, cyto_mito 9.5, nucl 9
Family & Domain DBs
Amino Acid Sequences MPRPVLVRCQIDETGSWNFVCPGACWRSVCGGEEDARGMEKEYPYYRYGGMWKNKHTDGPASAKKPKKVKEKQKERRAKRKEALAKSSEQSDEDGGRSEETTGEGLET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.22
4 0.18
5 0.17
6 0.17
7 0.17
8 0.14
9 0.16
10 0.18
11 0.2
12 0.21
13 0.22
14 0.25
15 0.25
16 0.26
17 0.22
18 0.21
19 0.2
20 0.2
21 0.19
22 0.14
23 0.14
24 0.13
25 0.11
26 0.12
27 0.1
28 0.13
29 0.14
30 0.17
31 0.18
32 0.19
33 0.18
34 0.17
35 0.21
36 0.25
37 0.31
38 0.32
39 0.35
40 0.38
41 0.38
42 0.38
43 0.34
44 0.29
45 0.25
46 0.29
47 0.31
48 0.32
49 0.39
50 0.43
51 0.48
52 0.53
53 0.58
54 0.61
55 0.65
56 0.72
57 0.75
58 0.82
59 0.87
60 0.9
61 0.93
62 0.93
63 0.93
64 0.91
65 0.9
66 0.85
67 0.85
68 0.84
69 0.82
70 0.79
71 0.72
72 0.67
73 0.59
74 0.56
75 0.47
76 0.37
77 0.3
78 0.25
79 0.23
80 0.19
81 0.2
82 0.17
83 0.17
84 0.16
85 0.15
86 0.13
87 0.13
88 0.13