Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2Y4N5

Protein Details
Accession M2Y4N5    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAKSSRSSRLKKNNAVLKKKVFHydrophilic
69-109DEANKPKKSQREVKRLQDARKQRRERSSHRKPRNQVAFPSHHydrophilic
NLS Segment(s)
PositionSequence
73-119KPKKSQREVKRLQDARKQRRERSSHRKPRNQVAFPSHPLKKRNGSKR
Subcellular Location(s) nucl 18, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSSRSSRLKKNNAVLKKKVFGPVETARIERQNAKLLELAKQPKEHMEVEETVDGVAKTKSTEDVDMDEANKPKKSQREVKRLQDARKQRRERSSHRKPRNQVAFPSHPLKKRNGSKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.82
4 0.78
5 0.72
6 0.67
7 0.65
8 0.58
9 0.48
10 0.47
11 0.44
12 0.43
13 0.4
14 0.38
15 0.33
16 0.34
17 0.35
18 0.32
19 0.3
20 0.31
21 0.3
22 0.3
23 0.3
24 0.28
25 0.3
26 0.32
27 0.34
28 0.29
29 0.3
30 0.29
31 0.29
32 0.31
33 0.28
34 0.23
35 0.2
36 0.18
37 0.19
38 0.19
39 0.16
40 0.12
41 0.12
42 0.1
43 0.08
44 0.07
45 0.05
46 0.05
47 0.05
48 0.07
49 0.08
50 0.09
51 0.09
52 0.11
53 0.12
54 0.13
55 0.13
56 0.15
57 0.16
58 0.18
59 0.18
60 0.18
61 0.21
62 0.27
63 0.34
64 0.41
65 0.49
66 0.58
67 0.66
68 0.74
69 0.8
70 0.8
71 0.79
72 0.78
73 0.79
74 0.78
75 0.8
76 0.79
77 0.77
78 0.8
79 0.82
80 0.83
81 0.84
82 0.84
83 0.85
84 0.88
85 0.89
86 0.87
87 0.89
88 0.89
89 0.83
90 0.8
91 0.78
92 0.75
93 0.71
94 0.72
95 0.68
96 0.64
97 0.62
98 0.62
99 0.63