Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3AX03

Protein Details
Accession M3AX03   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
6-36GKKRRIEDEVRPKKKKFIKKQKTYHSSSEDEBasic
NLS Segment(s)
PositionSequence
6-26GKKRRIEDEVRPKKKKFIKKQ
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR012459  Rrp15  
Gene Ontology GO:0006364  P:rRNA processing  
KEGG pfj:MYCFIDRAFT_154314  -  
Pfam View protein in Pfam  
PF07890  Rrp15p  
Amino Acid Sequences MAPIAGKKRRIEDEVRPKKKKFIKKQKTYHSSSEDEEDGPAQRASDAPAPKYVLKAKETVKKSEIHVGTTTSKPKSILKRVVPAPKPPSEPSEPSAFGDDSEDAEEEAADGGVDVLERNTALNGLPAEGSENDDDDGLPENDEPDLDQATSASDSESDGHASITSSQARTKKKRNDPDSMATSMLKILDTKLTASKRANPLLSRSKTPAEADKQLADAKLESKARAQIRAEKRALAEKGHVADVLGLQTPNVDTGAILEEEKRLKKTAQRGVVKLFNAVRAAQVKAEEARAEARKEGVVGMKKREERVNEMSKQGFLDLISKGGKAVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.77
3 0.78
4 0.74
5 0.78
6 0.81
7 0.81
8 0.81
9 0.81
10 0.81
11 0.84
12 0.92
13 0.94
14 0.93
15 0.89
16 0.87
17 0.82
18 0.74
19 0.66
20 0.6
21 0.51
22 0.42
23 0.36
24 0.28
25 0.23
26 0.22
27 0.19
28 0.14
29 0.13
30 0.12
31 0.15
32 0.2
33 0.22
34 0.22
35 0.26
36 0.29
37 0.29
38 0.34
39 0.36
40 0.35
41 0.33
42 0.38
43 0.41
44 0.47
45 0.5
46 0.51
47 0.48
48 0.46
49 0.47
50 0.5
51 0.44
52 0.39
53 0.36
54 0.34
55 0.35
56 0.36
57 0.39
58 0.31
59 0.32
60 0.3
61 0.36
62 0.42
63 0.47
64 0.52
65 0.51
66 0.58
67 0.64
68 0.72
69 0.68
70 0.67
71 0.64
72 0.6
73 0.6
74 0.53
75 0.52
76 0.48
77 0.48
78 0.42
79 0.42
80 0.37
81 0.34
82 0.34
83 0.28
84 0.22
85 0.21
86 0.18
87 0.13
88 0.13
89 0.12
90 0.09
91 0.09
92 0.08
93 0.06
94 0.06
95 0.05
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.04
107 0.04
108 0.04
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.08
115 0.08
116 0.09
117 0.08
118 0.08
119 0.08
120 0.08
121 0.08
122 0.07
123 0.1
124 0.08
125 0.08
126 0.07
127 0.08
128 0.07
129 0.08
130 0.07
131 0.05
132 0.06
133 0.05
134 0.05
135 0.05
136 0.05
137 0.06
138 0.06
139 0.05
140 0.04
141 0.05
142 0.06
143 0.06
144 0.06
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.08
151 0.09
152 0.09
153 0.12
154 0.19
155 0.26
156 0.33
157 0.42
158 0.5
159 0.59
160 0.68
161 0.71
162 0.73
163 0.72
164 0.72
165 0.66
166 0.58
167 0.49
168 0.39
169 0.33
170 0.25
171 0.19
172 0.12
173 0.08
174 0.07
175 0.07
176 0.07
177 0.08
178 0.14
179 0.15
180 0.19
181 0.2
182 0.27
183 0.31
184 0.34
185 0.36
186 0.32
187 0.37
188 0.43
189 0.44
190 0.41
191 0.38
192 0.36
193 0.36
194 0.36
195 0.36
196 0.31
197 0.33
198 0.32
199 0.29
200 0.29
201 0.28
202 0.27
203 0.2
204 0.16
205 0.13
206 0.16
207 0.17
208 0.16
209 0.17
210 0.23
211 0.24
212 0.29
213 0.3
214 0.35
215 0.42
216 0.5
217 0.49
218 0.44
219 0.44
220 0.46
221 0.45
222 0.37
223 0.32
224 0.27
225 0.27
226 0.26
227 0.24
228 0.16
229 0.15
230 0.14
231 0.12
232 0.1
233 0.08
234 0.07
235 0.08
236 0.08
237 0.08
238 0.07
239 0.06
240 0.04
241 0.06
242 0.08
243 0.08
244 0.08
245 0.08
246 0.12
247 0.17
248 0.19
249 0.21
250 0.21
251 0.24
252 0.3
253 0.39
254 0.45
255 0.5
256 0.55
257 0.57
258 0.62
259 0.64
260 0.58
261 0.54
262 0.46
263 0.4
264 0.34
265 0.3
266 0.28
267 0.24
268 0.25
269 0.21
270 0.2
271 0.2
272 0.2
273 0.22
274 0.18
275 0.17
276 0.22
277 0.25
278 0.26
279 0.25
280 0.25
281 0.23
282 0.23
283 0.24
284 0.25
285 0.29
286 0.32
287 0.38
288 0.44
289 0.48
290 0.52
291 0.56
292 0.54
293 0.54
294 0.59
295 0.61
296 0.57
297 0.59
298 0.56
299 0.51
300 0.46
301 0.39
302 0.3
303 0.22
304 0.21
305 0.15
306 0.17
307 0.17
308 0.16
309 0.16