Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3AQH7

Protein Details
Accession M3AQH7    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
26-55QRFHERPGMKRKRLKRQRWAKRFKDNFVRTBasic
NLS Segment(s)
PositionSequence
31-48RPGMKRKRLKRQRWAKRF
Subcellular Location(s) nucl 9, mito 9, cyto 9, cyto_nucl 9, cyto_mito 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pfj:MYCFIDRAFT_34946  -  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MDVGRAFRAMEMGCARNRVRRDFMDQRFHERPGMKRKRLKRQRWAKRFKDNFVRTVQLVQRMKKQGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.31
4 0.35
5 0.36
6 0.37
7 0.37
8 0.45
9 0.5
10 0.56
11 0.6
12 0.57
13 0.6
14 0.57
15 0.55
16 0.51
17 0.44
18 0.44
19 0.45
20 0.53
21 0.52
22 0.58
23 0.65
24 0.72
25 0.79
26 0.83
27 0.82
28 0.83
29 0.87
30 0.9
31 0.92
32 0.9
33 0.9
34 0.87
35 0.85
36 0.85
37 0.78
38 0.72
39 0.66
40 0.61
41 0.51
42 0.51
43 0.46
44 0.45
45 0.47
46 0.46
47 0.5