Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3A1Q3

Protein Details
Accession M3A1Q3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAVIKFIPGKQRKQRKPRQLGELLQTHydrophilic
NLS Segment(s)
PositionSequence
13-15KQR
Subcellular Location(s) nucl 10, cyto 8, mito 7
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_212354  -  
Amino Acid Sequences MAVIKFIPGKQRKQRKPRQLGELLQTLPQELFDKIYDLTFTAEPGLRDLGDIIGEDQGLTCRRRYRGQQFLGADTRALLQVDRASRAKFASSYYGEGSVFLAHSHFAASTWSDSVDPQHRRLIAALPRKLSWAEFCTHEAKNIIDAEYGHSKQILAELRKIGIRGLPTDQEWDNIYDLDLDGRLML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.92
4 0.91
5 0.9
6 0.88
7 0.83
8 0.78
9 0.73
10 0.63
11 0.54
12 0.46
13 0.37
14 0.27
15 0.23
16 0.18
17 0.12
18 0.13
19 0.11
20 0.13
21 0.12
22 0.13
23 0.12
24 0.11
25 0.13
26 0.11
27 0.11
28 0.12
29 0.13
30 0.12
31 0.14
32 0.14
33 0.11
34 0.11
35 0.11
36 0.09
37 0.07
38 0.07
39 0.06
40 0.06
41 0.06
42 0.05
43 0.05
44 0.07
45 0.1
46 0.11
47 0.13
48 0.18
49 0.21
50 0.27
51 0.36
52 0.43
53 0.5
54 0.53
55 0.57
56 0.54
57 0.55
58 0.52
59 0.43
60 0.34
61 0.24
62 0.2
63 0.14
64 0.12
65 0.08
66 0.06
67 0.09
68 0.1
69 0.13
70 0.14
71 0.14
72 0.14
73 0.15
74 0.15
75 0.12
76 0.13
77 0.14
78 0.14
79 0.16
80 0.15
81 0.16
82 0.15
83 0.14
84 0.14
85 0.09
86 0.08
87 0.06
88 0.05
89 0.04
90 0.05
91 0.05
92 0.04
93 0.04
94 0.05
95 0.06
96 0.06
97 0.06
98 0.07
99 0.07
100 0.07
101 0.11
102 0.19
103 0.21
104 0.22
105 0.26
106 0.26
107 0.26
108 0.27
109 0.3
110 0.29
111 0.36
112 0.36
113 0.35
114 0.35
115 0.36
116 0.35
117 0.3
118 0.26
119 0.2
120 0.19
121 0.19
122 0.22
123 0.25
124 0.24
125 0.25
126 0.23
127 0.2
128 0.22
129 0.21
130 0.18
131 0.15
132 0.15
133 0.17
134 0.23
135 0.23
136 0.2
137 0.19
138 0.18
139 0.17
140 0.23
141 0.26
142 0.22
143 0.26
144 0.27
145 0.29
146 0.3
147 0.3
148 0.26
149 0.21
150 0.2
151 0.19
152 0.21
153 0.23
154 0.22
155 0.26
156 0.26
157 0.25
158 0.25
159 0.24
160 0.21
161 0.18
162 0.17
163 0.14
164 0.13
165 0.12
166 0.11