Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3BCV0

Protein Details
Accession M3BCV0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-41REPSDRKRKTYDPKNAKDPYKBasic
NLS Segment(s)
PositionSequence
70-87KKRQAGSDPGSRQPKKQK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_77212  -  
Amino Acid Sequences MVQIKYNALVVIPIDYDGECREPSDRKRKTYDPKNAKDPYKPYTVDLPEFLLELGAPRCLRDTRVGPASKKRQAGSDPGSRQPKKQKPTGARVALNSIPQVANRLVRTPALSRATQKVAPKPKMARPQCIVRNRAIETIDLTDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.1
4 0.11
5 0.13
6 0.12
7 0.12
8 0.16
9 0.22
10 0.31
11 0.41
12 0.46
13 0.5
14 0.57
15 0.66
16 0.73
17 0.77
18 0.79
19 0.79
20 0.79
21 0.83
22 0.83
23 0.78
24 0.74
25 0.69
26 0.62
27 0.58
28 0.52
29 0.44
30 0.44
31 0.43
32 0.37
33 0.33
34 0.3
35 0.23
36 0.22
37 0.2
38 0.12
39 0.08
40 0.08
41 0.07
42 0.08
43 0.08
44 0.08
45 0.1
46 0.11
47 0.13
48 0.15
49 0.17
50 0.2
51 0.27
52 0.3
53 0.31
54 0.39
55 0.46
56 0.47
57 0.48
58 0.43
59 0.39
60 0.38
61 0.42
62 0.39
63 0.39
64 0.37
65 0.4
66 0.49
67 0.47
68 0.51
69 0.55
70 0.57
71 0.54
72 0.58
73 0.6
74 0.58
75 0.66
76 0.7
77 0.66
78 0.6
79 0.56
80 0.54
81 0.46
82 0.39
83 0.31
84 0.23
85 0.17
86 0.14
87 0.16
88 0.13
89 0.16
90 0.16
91 0.18
92 0.17
93 0.18
94 0.21
95 0.2
96 0.26
97 0.25
98 0.27
99 0.28
100 0.32
101 0.36
102 0.37
103 0.41
104 0.43
105 0.49
106 0.52
107 0.56
108 0.58
109 0.62
110 0.69
111 0.69
112 0.69
113 0.64
114 0.7
115 0.71
116 0.73
117 0.68
118 0.63
119 0.65
120 0.59
121 0.57
122 0.48
123 0.4
124 0.35