Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2ZJ76

Protein Details
Accession M2ZJ76   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
327-351GLPSAKRPEPEKRKSWLKRRFSKKDBasic
NLS Segment(s)
PositionSequence
331-351AKRPEPEKRKSWLKRRFSKKD
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018809  DUF2406  
KEGG pfj:MYCFIDRAFT_87432  -  
Pfam View protein in Pfam  
PF10295  DUF2406  
Amino Acid Sequences MADPRPHSPHTSASRPHASRSRTFSFRSDKSGASQPKEHLVESPKEKQRRDSIWKSTSKANPNAALVEAQPGGIQHKDAYGNPITDPDLANPTRPRMERPLDTIRSFEAAIDSGYKRRSTFMRSESDNQMGGGGGGGYAASGRNSSYGEYTHSFRRMSVANRRMSGFGDGPSPNNRYAYGNGGGGGYYGGQRDSHASAGPSARPRYGRGMQSDPMMQARPYPPQHGYQHSQDTMNTAHGSDSTGPWNSGTDPSSENSSIDKNYQNGQQNGYHNGYGANGFSGPIPEEGGAYPVKPGYGGAPAVLPPNARRPIPLGNSDGMPVMPNSGLPSAKRPEPEKRKSWLKRRFSKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.6
3 0.65
4 0.63
5 0.61
6 0.6
7 0.62
8 0.62
9 0.57
10 0.59
11 0.59
12 0.61
13 0.58
14 0.59
15 0.54
16 0.48
17 0.48
18 0.54
19 0.53
20 0.5
21 0.51
22 0.46
23 0.51
24 0.51
25 0.47
26 0.43
27 0.41
28 0.44
29 0.46
30 0.53
31 0.54
32 0.59
33 0.61
34 0.63
35 0.67
36 0.68
37 0.71
38 0.71
39 0.72
40 0.73
41 0.77
42 0.72
43 0.72
44 0.7
45 0.69
46 0.66
47 0.62
48 0.56
49 0.51
50 0.49
51 0.41
52 0.34
53 0.25
54 0.21
55 0.16
56 0.12
57 0.11
58 0.1
59 0.12
60 0.11
61 0.11
62 0.09
63 0.11
64 0.14
65 0.14
66 0.19
67 0.19
68 0.2
69 0.19
70 0.21
71 0.19
72 0.18
73 0.18
74 0.15
75 0.19
76 0.19
77 0.23
78 0.24
79 0.26
80 0.31
81 0.31
82 0.34
83 0.35
84 0.41
85 0.4
86 0.45
87 0.51
88 0.5
89 0.5
90 0.47
91 0.4
92 0.35
93 0.31
94 0.24
95 0.15
96 0.11
97 0.1
98 0.12
99 0.12
100 0.14
101 0.16
102 0.17
103 0.16
104 0.19
105 0.21
106 0.24
107 0.3
108 0.33
109 0.37
110 0.4
111 0.45
112 0.46
113 0.45
114 0.4
115 0.32
116 0.26
117 0.2
118 0.15
119 0.1
120 0.06
121 0.03
122 0.03
123 0.03
124 0.02
125 0.02
126 0.03
127 0.03
128 0.03
129 0.04
130 0.05
131 0.06
132 0.06
133 0.07
134 0.08
135 0.11
136 0.13
137 0.15
138 0.18
139 0.2
140 0.2
141 0.19
142 0.21
143 0.21
144 0.24
145 0.32
146 0.36
147 0.37
148 0.38
149 0.39
150 0.37
151 0.35
152 0.32
153 0.23
154 0.16
155 0.16
156 0.15
157 0.16
158 0.19
159 0.2
160 0.18
161 0.17
162 0.18
163 0.15
164 0.16
165 0.18
166 0.16
167 0.14
168 0.14
169 0.13
170 0.12
171 0.1
172 0.09
173 0.05
174 0.05
175 0.05
176 0.05
177 0.05
178 0.05
179 0.08
180 0.09
181 0.09
182 0.09
183 0.09
184 0.11
185 0.13
186 0.15
187 0.18
188 0.18
189 0.2
190 0.2
191 0.22
192 0.27
193 0.31
194 0.33
195 0.33
196 0.36
197 0.35
198 0.36
199 0.35
200 0.28
201 0.25
202 0.21
203 0.16
204 0.16
205 0.16
206 0.22
207 0.22
208 0.25
209 0.26
210 0.32
211 0.36
212 0.38
213 0.41
214 0.39
215 0.43
216 0.4
217 0.39
218 0.32
219 0.31
220 0.25
221 0.23
222 0.18
223 0.13
224 0.11
225 0.11
226 0.12
227 0.11
228 0.11
229 0.12
230 0.13
231 0.13
232 0.13
233 0.13
234 0.13
235 0.15
236 0.14
237 0.13
238 0.14
239 0.15
240 0.19
241 0.19
242 0.18
243 0.17
244 0.19
245 0.18
246 0.2
247 0.22
248 0.19
249 0.22
250 0.28
251 0.34
252 0.34
253 0.36
254 0.38
255 0.39
256 0.42
257 0.42
258 0.35
259 0.28
260 0.26
261 0.23
262 0.18
263 0.15
264 0.1
265 0.08
266 0.08
267 0.08
268 0.08
269 0.09
270 0.09
271 0.09
272 0.08
273 0.09
274 0.09
275 0.11
276 0.11
277 0.1
278 0.1
279 0.09
280 0.09
281 0.08
282 0.09
283 0.08
284 0.11
285 0.12
286 0.11
287 0.12
288 0.13
289 0.15
290 0.16
291 0.15
292 0.14
293 0.23
294 0.27
295 0.26
296 0.27
297 0.3
298 0.38
299 0.42
300 0.44
301 0.39
302 0.37
303 0.38
304 0.36
305 0.32
306 0.24
307 0.19
308 0.14
309 0.12
310 0.1
311 0.1
312 0.11
313 0.14
314 0.16
315 0.17
316 0.23
317 0.27
318 0.31
319 0.37
320 0.41
321 0.49
322 0.58
323 0.65
324 0.66
325 0.7
326 0.77
327 0.81
328 0.86
329 0.86
330 0.86
331 0.87