Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2ZZS5

Protein Details
Accession M2ZZS5   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
74-93RQALQRKERKQTSTKPRPNLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14, nucl 11.5, cyto 7.5, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036736  ACP-like_sf  
IPR020806  PKS_PP-bd  
IPR009081  PP-bd_ACP  
IPR006162  Ppantetheine_attach_site  
Gene Ontology GO:0031177  F:phosphopantetheine binding  
KEGG pfj:MYCFIDRAFT_212530  -  
Pfam View protein in Pfam  
PF00550  PP-binding  
PROSITE View protein in PROSITE  
PS50075  CARRIER  
PS00012  PHOSPHOPANTETHEINE  
Amino Acid Sequences MGEADQKLCKIVLDATQAILDKGPIDADTNLFRLGLDSILAIRLSSKLRRTEVPLAVNDIMQGKTIAEMVARMRQALQRKERKQTSTKPRPNLLDSEQETAAIQALG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.22
4 0.22
5 0.21
6 0.18
7 0.14
8 0.08
9 0.08
10 0.08
11 0.06
12 0.08
13 0.08
14 0.1
15 0.12
16 0.13
17 0.13
18 0.12
19 0.12
20 0.1
21 0.1
22 0.08
23 0.06
24 0.05
25 0.05
26 0.06
27 0.06
28 0.05
29 0.05
30 0.07
31 0.09
32 0.13
33 0.17
34 0.2
35 0.22
36 0.24
37 0.3
38 0.35
39 0.36
40 0.35
41 0.31
42 0.31
43 0.29
44 0.27
45 0.22
46 0.16
47 0.12
48 0.1
49 0.1
50 0.06
51 0.06
52 0.06
53 0.06
54 0.04
55 0.06
56 0.07
57 0.11
58 0.11
59 0.11
60 0.12
61 0.16
62 0.24
63 0.32
64 0.4
65 0.47
66 0.53
67 0.63
68 0.69
69 0.72
70 0.73
71 0.75
72 0.76
73 0.77
74 0.8
75 0.79
76 0.79
77 0.78
78 0.73
79 0.69
80 0.62
81 0.6
82 0.55
83 0.51
84 0.43
85 0.38
86 0.34
87 0.27