Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DND9

Protein Details
Accession B0DND9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-27LDNKVRKVENKVRQKVRGKLATHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 9.166, mito 9, cyto 9, cyto_nucl 7.833, cyto_pero 6.333
Family & Domain DBs
KEGG lbc:LACBIDRAFT_306593  -  
Amino Acid Sequences MSGQVLDNKVRKVENKVRQKVRGKLATGLCDRWKNIAKTSVVSSLMTVDTIPYLVQTHNVMHDAKTGDHLLKLVLEDIVLMETKYGVILIAWCTDDSPDGKKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.59
3 0.67
4 0.73
5 0.78
6 0.83
7 0.81
8 0.81
9 0.78
10 0.69
11 0.67
12 0.62
13 0.59
14 0.54
15 0.49
16 0.45
17 0.41
18 0.39
19 0.37
20 0.4
21 0.35
22 0.36
23 0.38
24 0.34
25 0.32
26 0.34
27 0.31
28 0.26
29 0.24
30 0.2
31 0.15
32 0.14
33 0.12
34 0.09
35 0.06
36 0.05
37 0.05
38 0.04
39 0.04
40 0.04
41 0.04
42 0.06
43 0.07
44 0.07
45 0.08
46 0.1
47 0.1
48 0.1
49 0.13
50 0.13
51 0.12
52 0.14
53 0.14
54 0.13
55 0.13
56 0.13
57 0.1
58 0.09
59 0.09
60 0.08
61 0.06
62 0.05
63 0.05
64 0.05
65 0.06
66 0.05
67 0.05
68 0.04
69 0.04
70 0.05
71 0.05
72 0.04
73 0.03
74 0.04
75 0.05
76 0.07
77 0.08
78 0.09
79 0.1
80 0.1
81 0.11
82 0.13
83 0.14