Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3AM88

Protein Details
Accession M3AM88    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
34-55SEKADDKSKRTQPKRNPASADQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 9, cyto_mito 9
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_183928  -  
Amino Acid Sequences MDPPKSNTSTANTGIFAAIRRPSLASILSSGSASEKADDKSKRTQPKRNPASADQIFQVLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.17
4 0.15
5 0.14
6 0.12
7 0.12
8 0.13
9 0.13
10 0.14
11 0.14
12 0.11
13 0.1
14 0.11
15 0.1
16 0.09
17 0.09
18 0.08
19 0.08
20 0.07
21 0.07
22 0.08
23 0.09
24 0.17
25 0.19
26 0.22
27 0.3
28 0.39
29 0.49
30 0.55
31 0.64
32 0.68
33 0.77
34 0.83
35 0.82
36 0.8
37 0.74
38 0.76
39 0.69
40 0.61
41 0.51
42 0.43