Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3AL53

Protein Details
Accession M3AL53    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
261-300VEKFNKMKSKDREKLIERKRKKEGQKEKRRMPSARRIPAGBasic
NLS Segment(s)
PositionSequence
193-300AAKRTKNEDDKEKLKRKVGSMENRLKAKEAKEREQEILKRHRKEERERVEQGKNPYYLKKKDIKEKALVEKFNKMKSKDREKLIERKRKKEGQKEKRRMPSARRIPAG
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009292  RRP36  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0000469  P:cleavage involved in rRNA processing  
KEGG pfj:MYCFIDRAFT_150394  -  
Pfam View protein in Pfam  
PF06102  RRP36  
Amino Acid Sequences MDDESRSDAEDSASDASEVQADSKQTLSDVVQNSGLSFDALQTAFKDAANAQSRKRKRGSHTSQDQEDKLQALRERLRQIKDQKAVSGASRQNSRSDAKVNQNQDEHDSDSDSDSGPSEEGAPSRTSKHAPTAQSSKFQVSRKRQVVDVPKRVVRDPRFDPLHQKSAHPGNSEKAYSFLLDYQKDEIKELKEAAKRTKNEDDKEKLKRKVGSMENRLKAKEAKEREQEILKRHRKEERERVEQGKNPYYLKKKDIKEKALVEKFNKMKSKDREKLIERKRKKEGQKEKRRMPSARRIPAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.11
4 0.12
5 0.12
6 0.11
7 0.12
8 0.12
9 0.13
10 0.14
11 0.14
12 0.12
13 0.14
14 0.14
15 0.18
16 0.2
17 0.21
18 0.22
19 0.22
20 0.21
21 0.2
22 0.19
23 0.12
24 0.1
25 0.08
26 0.1
27 0.1
28 0.1
29 0.1
30 0.13
31 0.13
32 0.13
33 0.14
34 0.11
35 0.2
36 0.28
37 0.3
38 0.34
39 0.44
40 0.5
41 0.56
42 0.62
43 0.62
44 0.61
45 0.7
46 0.73
47 0.74
48 0.79
49 0.79
50 0.79
51 0.76
52 0.69
53 0.6
54 0.52
55 0.42
56 0.33
57 0.3
58 0.25
59 0.26
60 0.3
61 0.34
62 0.4
63 0.45
64 0.48
65 0.51
66 0.57
67 0.6
68 0.61
69 0.56
70 0.5
71 0.46
72 0.44
73 0.37
74 0.38
75 0.32
76 0.3
77 0.33
78 0.32
79 0.32
80 0.34
81 0.35
82 0.29
83 0.31
84 0.32
85 0.37
86 0.43
87 0.44
88 0.45
89 0.44
90 0.42
91 0.41
92 0.37
93 0.3
94 0.24
95 0.21
96 0.17
97 0.17
98 0.16
99 0.13
100 0.11
101 0.09
102 0.09
103 0.07
104 0.07
105 0.07
106 0.07
107 0.07
108 0.08
109 0.09
110 0.1
111 0.12
112 0.14
113 0.15
114 0.16
115 0.22
116 0.26
117 0.26
118 0.3
119 0.36
120 0.36
121 0.38
122 0.38
123 0.36
124 0.36
125 0.38
126 0.42
127 0.43
128 0.51
129 0.52
130 0.51
131 0.49
132 0.5
133 0.56
134 0.57
135 0.56
136 0.5
137 0.47
138 0.47
139 0.48
140 0.5
141 0.42
142 0.4
143 0.35
144 0.39
145 0.41
146 0.4
147 0.47
148 0.44
149 0.48
150 0.42
151 0.39
152 0.36
153 0.39
154 0.41
155 0.35
156 0.31
157 0.27
158 0.29
159 0.29
160 0.25
161 0.19
162 0.16
163 0.14
164 0.14
165 0.14
166 0.15
167 0.15
168 0.16
169 0.18
170 0.2
171 0.2
172 0.2
173 0.2
174 0.17
175 0.18
176 0.19
177 0.23
178 0.24
179 0.28
180 0.35
181 0.4
182 0.4
183 0.45
184 0.53
185 0.54
186 0.56
187 0.61
188 0.6
189 0.6
190 0.69
191 0.71
192 0.67
193 0.65
194 0.64
195 0.59
196 0.6
197 0.62
198 0.61
199 0.62
200 0.66
201 0.66
202 0.65
203 0.62
204 0.56
205 0.51
206 0.46
207 0.45
208 0.43
209 0.45
210 0.5
211 0.54
212 0.55
213 0.59
214 0.58
215 0.57
216 0.61
217 0.61
218 0.58
219 0.6
220 0.65
221 0.65
222 0.71
223 0.74
224 0.72
225 0.73
226 0.74
227 0.75
228 0.74
229 0.71
230 0.68
231 0.65
232 0.58
233 0.53
234 0.55
235 0.57
236 0.55
237 0.57
238 0.58
239 0.59
240 0.66
241 0.72
242 0.71
243 0.71
244 0.74
245 0.76
246 0.75
247 0.75
248 0.67
249 0.67
250 0.65
251 0.65
252 0.64
253 0.58
254 0.6
255 0.63
256 0.71
257 0.7
258 0.72
259 0.74
260 0.74
261 0.81
262 0.82
263 0.83
264 0.81
265 0.82
266 0.84
267 0.84
268 0.86
269 0.87
270 0.88
271 0.88
272 0.9
273 0.92
274 0.92
275 0.93
276 0.92
277 0.9
278 0.88
279 0.88
280 0.87