Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3BA89

Protein Details
Accession M3BA89   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
36-59PESPALKKKLLKRKRDSEKDHADTBasic
NLS Segment(s)
PositionSequence
42-50KKKLLKRKR
Subcellular Location(s) nucl 14, mito 6, pero 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG pfj:MYCFIDRAFT_131958  -  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MVYLATAEEWQQQSMLLLQARPTTTRITTKYNIPNPESPALKKKLLKRKRDSEKDHADTAAAAATEAQVATLTLKTYDPASGVVLKFQTDKAAHVGRLINSLGRAGRHMAALPEQQEGEKRTCWDATAWMLRYAQLSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.14
4 0.14
5 0.15
6 0.19
7 0.2
8 0.21
9 0.21
10 0.21
11 0.23
12 0.29
13 0.31
14 0.34
15 0.36
16 0.43
17 0.51
18 0.54
19 0.56
20 0.54
21 0.54
22 0.52
23 0.54
24 0.49
25 0.42
26 0.43
27 0.42
28 0.43
29 0.44
30 0.49
31 0.55
32 0.61
33 0.68
34 0.69
35 0.75
36 0.81
37 0.86
38 0.85
39 0.83
40 0.85
41 0.78
42 0.7
43 0.59
44 0.48
45 0.38
46 0.3
47 0.21
48 0.1
49 0.06
50 0.04
51 0.04
52 0.04
53 0.04
54 0.03
55 0.02
56 0.03
57 0.03
58 0.04
59 0.04
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.06
66 0.07
67 0.08
68 0.1
69 0.1
70 0.11
71 0.11
72 0.11
73 0.12
74 0.11
75 0.14
76 0.12
77 0.13
78 0.17
79 0.19
80 0.19
81 0.21
82 0.23
83 0.19
84 0.21
85 0.21
86 0.16
87 0.14
88 0.16
89 0.14
90 0.12
91 0.13
92 0.13
93 0.13
94 0.13
95 0.14
96 0.13
97 0.16
98 0.19
99 0.18
100 0.18
101 0.17
102 0.17
103 0.21
104 0.23
105 0.22
106 0.22
107 0.23
108 0.25
109 0.25
110 0.26
111 0.23
112 0.24
113 0.28
114 0.33
115 0.32
116 0.32
117 0.32
118 0.32