Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3AXU2

Protein Details
Accession M3AXU2    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
125-150EDQKKEEKRYHGPQRRGHRKGKGNGKBasic
NLS Segment(s)
PositionSequence
128-150KKEEKRYHGPQRRGHRKGKGNGK
Subcellular Location(s) nucl 15, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
KEGG pfj:MYCFIDRAFT_211502  -  
Amino Acid Sequences MKEESSRVGPQQQDKVSSHLLQYTTQHTLMHHTSITTMTLLSPSRIHSTTISVPDRMVTPCRSHNSYTFWAVPAQDYLLRTIQVSGHTPVEDAAATMALYLRKFPYDRVSGAAKWVPMYERKSVEDQKKEEKRYHGPQRRGHRKGKGNGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.47
4 0.43
5 0.37
6 0.33
7 0.31
8 0.27
9 0.28
10 0.28
11 0.27
12 0.26
13 0.25
14 0.21
15 0.26
16 0.25
17 0.25
18 0.2
19 0.16
20 0.16
21 0.16
22 0.17
23 0.11
24 0.09
25 0.07
26 0.1
27 0.1
28 0.11
29 0.11
30 0.12
31 0.16
32 0.17
33 0.18
34 0.17
35 0.2
36 0.23
37 0.29
38 0.28
39 0.25
40 0.24
41 0.23
42 0.24
43 0.21
44 0.2
45 0.16
46 0.17
47 0.22
48 0.27
49 0.29
50 0.3
51 0.31
52 0.33
53 0.34
54 0.34
55 0.29
56 0.25
57 0.23
58 0.21
59 0.19
60 0.13
61 0.11
62 0.09
63 0.09
64 0.1
65 0.1
66 0.09
67 0.09
68 0.09
69 0.1
70 0.1
71 0.12
72 0.11
73 0.12
74 0.12
75 0.12
76 0.11
77 0.11
78 0.09
79 0.07
80 0.05
81 0.04
82 0.04
83 0.04
84 0.05
85 0.06
86 0.06
87 0.07
88 0.08
89 0.1
90 0.11
91 0.13
92 0.19
93 0.21
94 0.22
95 0.24
96 0.28
97 0.26
98 0.29
99 0.3
100 0.23
101 0.2
102 0.2
103 0.19
104 0.21
105 0.25
106 0.27
107 0.28
108 0.31
109 0.37
110 0.45
111 0.52
112 0.54
113 0.56
114 0.61
115 0.67
116 0.7
117 0.69
118 0.68
119 0.68
120 0.7
121 0.76
122 0.76
123 0.76
124 0.79
125 0.84
126 0.88
127 0.87
128 0.85
129 0.84
130 0.84