Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2Z1U9

Protein Details
Accession M2Z1U9    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
70-91LRAVPKKKTSHMKKRHRQMAGKBasic
NLS Segment(s)
PositionSequence
74-87PKKKTSHMKKRHRQ
Subcellular Location(s) mito 16.5, cyto_mito 9.5, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pfj:MYCFIDRAFT_60597  -  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAAFRAPSASFLAAFLPVARERLIHEPATRRIPLLQQIQQLRIDAALSPLLPAALTPIPSLLGQLWEGVLRAVPKKKTSHMKKRHRQMAGKALKDVTALNKCSACGRLKRAHVLCPYCVTSIKQWFANGFKSKQEVEELEKKRFEDLNDSLRARGRRPLQWESLYGEKKSPAEAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.12
4 0.12
5 0.13
6 0.13
7 0.12
8 0.15
9 0.21
10 0.25
11 0.24
12 0.28
13 0.33
14 0.39
15 0.44
16 0.41
17 0.36
18 0.35
19 0.36
20 0.38
21 0.39
22 0.39
23 0.39
24 0.42
25 0.44
26 0.43
27 0.39
28 0.32
29 0.25
30 0.2
31 0.13
32 0.11
33 0.09
34 0.08
35 0.07
36 0.07
37 0.06
38 0.06
39 0.05
40 0.07
41 0.07
42 0.08
43 0.08
44 0.08
45 0.09
46 0.09
47 0.1
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.06
54 0.06
55 0.05
56 0.06
57 0.06
58 0.1
59 0.15
60 0.17
61 0.21
62 0.23
63 0.3
64 0.4
65 0.49
66 0.56
67 0.63
68 0.72
69 0.77
70 0.84
71 0.86
72 0.83
73 0.78
74 0.73
75 0.73
76 0.69
77 0.61
78 0.52
79 0.44
80 0.37
81 0.32
82 0.26
83 0.21
84 0.18
85 0.18
86 0.18
87 0.18
88 0.18
89 0.19
90 0.22
91 0.21
92 0.21
93 0.26
94 0.31
95 0.34
96 0.42
97 0.43
98 0.46
99 0.49
100 0.47
101 0.42
102 0.39
103 0.39
104 0.31
105 0.31
106 0.26
107 0.25
108 0.29
109 0.3
110 0.28
111 0.27
112 0.28
113 0.3
114 0.36
115 0.35
116 0.3
117 0.3
118 0.32
119 0.32
120 0.31
121 0.32
122 0.27
123 0.28
124 0.36
125 0.38
126 0.4
127 0.42
128 0.41
129 0.41
130 0.41
131 0.36
132 0.34
133 0.35
134 0.37
135 0.41
136 0.42
137 0.4
138 0.43
139 0.44
140 0.38
141 0.41
142 0.4
143 0.4
144 0.46
145 0.51
146 0.53
147 0.54
148 0.55
149 0.52
150 0.55
151 0.53
152 0.47
153 0.43
154 0.39
155 0.36