Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1D8PFE0

Protein Details
Accession A0A1D8PFE0    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
55-74SLPPKPSHLQPQNRPQHQQQHydrophilic
167-199DDSHSDLKHKMKRNEKNRIRSLRRKPRFHYTKLBasic
NLS Segment(s)
PositionSequence
174-193KHKMKRNEKNRIRSLRRKPR
Subcellular Location(s) plas 22, nucl 2, pero 1, golg 1, vacu 1, mito_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR002610  Peptidase_S54_rhomboid  
IPR022764  Peptidase_S54_rhomboid_dom  
IPR035952  Rhomboid-like_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0004252  F:serine-type endopeptidase activity  
GO:0030447  P:filamentous growth  
GO:0044182  P:filamentous growth of a population of unicellular organisms  
GO:1900429  P:negative regulation of filamentous growth of a population of unicellular organisms  
GO:0006508  P:proteolysis  
KEGG cal:CAALFM_C112290CA  -  
Pfam View protein in Pfam  
PF01694  Rhomboid  
Amino Acid Sequences MPLNTPYPVEKNTFNISDEDDDFPTRNLNESSPLTQSTKRYMKQDFANSVTSLPSLPPKPSHLQPQNRPQHQQQQQQQQYPYGNLSAKQSNKHKQMFENSVPETNKKDYLGNTTTVRELPPIPDNEKLHSKNPFSDSRYASRDYDDVDLPPSPPHSDPFRNDEISDDDSHSDLKHKMKRNEKNRIRSLRRKPRFHYTKLPYFTMVISLIQIIVFIVELAKMAHLTGSAFQTKPYFNPMLGPSTFLLINMGARYVPCMHQIKDITDDTSILFPCANSTSVDTYVCSLSELCGLTKLKLSSDGSAYLPDQWYRIFIPIFLHAGFLHIIFNLLLQVTMGSSIERNIGIIKYAIIYISSGIGGFLLGANFTPQGIASTGASGALFGIVATNIILFIYTGKKNTNMYGTKHYALFICIMIGEIVISLVLGLLPGLDNFSHIGGFAMGILSSIVVLKDPFWVFIDGIITYPKNPSTWQQFLNNWNPMYSIEDKIRSRFFIWCGVRIIALILMIIYLVLLCKNFFNNDINRGNNCKWCKYFNCIPVKGWCDIGQVSVTSTTTTSDSNSNSNSNSNPTTTASSSSSSVPTTRYSTMTYTTSMPSSVENPKSNTNSEGTNGGLRKRFASSFTGGNSGGTANIAARAGGDIQQQYGIGSGLYVIVIFFTISFLKKKKII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.33
4 0.34
5 0.34
6 0.32
7 0.28
8 0.27
9 0.27
10 0.25
11 0.26
12 0.22
13 0.23
14 0.22
15 0.21
16 0.25
17 0.28
18 0.31
19 0.3
20 0.33
21 0.33
22 0.36
23 0.39
24 0.42
25 0.47
26 0.49
27 0.53
28 0.54
29 0.57
30 0.61
31 0.67
32 0.63
33 0.58
34 0.57
35 0.5
36 0.46
37 0.4
38 0.32
39 0.23
40 0.18
41 0.21
42 0.2
43 0.23
44 0.26
45 0.31
46 0.37
47 0.41
48 0.51
49 0.54
50 0.62
51 0.67
52 0.75
53 0.79
54 0.8
55 0.81
56 0.78
57 0.78
58 0.77
59 0.78
60 0.76
61 0.77
62 0.79
63 0.8
64 0.75
65 0.7
66 0.63
67 0.56
68 0.49
69 0.42
70 0.36
71 0.3
72 0.33
73 0.34
74 0.35
75 0.41
76 0.48
77 0.53
78 0.61
79 0.66
80 0.65
81 0.65
82 0.7
83 0.71
84 0.68
85 0.65
86 0.59
87 0.59
88 0.56
89 0.52
90 0.47
91 0.42
92 0.39
93 0.33
94 0.34
95 0.29
96 0.35
97 0.36
98 0.35
99 0.34
100 0.32
101 0.33
102 0.3
103 0.29
104 0.23
105 0.21
106 0.2
107 0.24
108 0.27
109 0.28
110 0.34
111 0.35
112 0.38
113 0.46
114 0.46
115 0.45
116 0.48
117 0.48
118 0.47
119 0.51
120 0.53
121 0.48
122 0.53
123 0.52
124 0.51
125 0.52
126 0.49
127 0.45
128 0.4
129 0.36
130 0.31
131 0.29
132 0.24
133 0.2
134 0.19
135 0.19
136 0.17
137 0.17
138 0.17
139 0.16
140 0.16
141 0.19
142 0.24
143 0.3
144 0.33
145 0.38
146 0.42
147 0.41
148 0.4
149 0.38
150 0.35
151 0.32
152 0.3
153 0.25
154 0.2
155 0.19
156 0.2
157 0.18
158 0.17
159 0.18
160 0.24
161 0.31
162 0.39
163 0.47
164 0.57
165 0.67
166 0.74
167 0.81
168 0.83
169 0.85
170 0.86
171 0.89
172 0.88
173 0.88
174 0.89
175 0.89
176 0.9
177 0.88
178 0.83
179 0.84
180 0.83
181 0.79
182 0.78
183 0.76
184 0.75
185 0.7
186 0.67
187 0.57
188 0.49
189 0.42
190 0.33
191 0.25
192 0.16
193 0.12
194 0.1
195 0.09
196 0.07
197 0.07
198 0.05
199 0.04
200 0.03
201 0.03
202 0.03
203 0.03
204 0.03
205 0.03
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.05
212 0.06
213 0.09
214 0.12
215 0.12
216 0.13
217 0.15
218 0.16
219 0.16
220 0.21
221 0.19
222 0.16
223 0.2
224 0.21
225 0.23
226 0.22
227 0.24
228 0.18
229 0.18
230 0.18
231 0.14
232 0.13
233 0.08
234 0.09
235 0.07
236 0.07
237 0.05
238 0.05
239 0.07
240 0.08
241 0.09
242 0.14
243 0.18
244 0.18
245 0.24
246 0.25
247 0.25
248 0.28
249 0.28
250 0.23
251 0.2
252 0.19
253 0.15
254 0.15
255 0.14
256 0.09
257 0.09
258 0.07
259 0.08
260 0.09
261 0.09
262 0.08
263 0.09
264 0.11
265 0.12
266 0.13
267 0.12
268 0.12
269 0.11
270 0.1
271 0.09
272 0.07
273 0.06
274 0.09
275 0.09
276 0.07
277 0.11
278 0.12
279 0.12
280 0.15
281 0.15
282 0.13
283 0.17
284 0.18
285 0.15
286 0.16
287 0.17
288 0.14
289 0.15
290 0.15
291 0.13
292 0.12
293 0.11
294 0.1
295 0.09
296 0.1
297 0.1
298 0.11
299 0.1
300 0.1
301 0.11
302 0.12
303 0.13
304 0.12
305 0.12
306 0.09
307 0.1
308 0.1
309 0.09
310 0.07
311 0.05
312 0.06
313 0.05
314 0.05
315 0.04
316 0.04
317 0.03
318 0.03
319 0.03
320 0.03
321 0.03
322 0.03
323 0.03
324 0.03
325 0.04
326 0.05
327 0.05
328 0.05
329 0.06
330 0.05
331 0.06
332 0.06
333 0.06
334 0.05
335 0.05
336 0.05
337 0.04
338 0.05
339 0.04
340 0.04
341 0.04
342 0.04
343 0.03
344 0.03
345 0.03
346 0.03
347 0.03
348 0.03
349 0.03
350 0.03
351 0.03
352 0.03
353 0.03
354 0.03
355 0.03
356 0.04
357 0.05
358 0.06
359 0.05
360 0.06
361 0.06
362 0.06
363 0.06
364 0.05
365 0.04
366 0.03
367 0.03
368 0.02
369 0.03
370 0.02
371 0.03
372 0.03
373 0.02
374 0.02
375 0.02
376 0.03
377 0.02
378 0.04
379 0.08
380 0.09
381 0.1
382 0.11
383 0.14
384 0.15
385 0.17
386 0.23
387 0.23
388 0.26
389 0.32
390 0.35
391 0.34
392 0.33
393 0.33
394 0.25
395 0.22
396 0.2
397 0.12
398 0.09
399 0.07
400 0.07
401 0.06
402 0.05
403 0.04
404 0.03
405 0.03
406 0.02
407 0.02
408 0.02
409 0.02
410 0.02
411 0.02
412 0.02
413 0.02
414 0.02
415 0.02
416 0.03
417 0.03
418 0.04
419 0.05
420 0.05
421 0.05
422 0.05
423 0.06
424 0.05
425 0.05
426 0.04
427 0.04
428 0.03
429 0.03
430 0.03
431 0.03
432 0.03
433 0.03
434 0.03
435 0.04
436 0.04
437 0.04
438 0.09
439 0.09
440 0.1
441 0.12
442 0.13
443 0.12
444 0.13
445 0.14
446 0.1
447 0.1
448 0.11
449 0.1
450 0.09
451 0.11
452 0.11
453 0.11
454 0.12
455 0.17
456 0.24
457 0.29
458 0.31
459 0.35
460 0.39
461 0.45
462 0.52
463 0.52
464 0.43
465 0.39
466 0.36
467 0.31
468 0.31
469 0.27
470 0.22
471 0.2
472 0.27
473 0.28
474 0.31
475 0.33
476 0.3
477 0.29
478 0.3
479 0.29
480 0.32
481 0.33
482 0.32
483 0.33
484 0.31
485 0.29
486 0.25
487 0.23
488 0.14
489 0.11
490 0.08
491 0.05
492 0.04
493 0.04
494 0.03
495 0.03
496 0.02
497 0.02
498 0.03
499 0.04
500 0.04
501 0.06
502 0.07
503 0.09
504 0.12
505 0.17
506 0.2
507 0.28
508 0.32
509 0.35
510 0.37
511 0.43
512 0.44
513 0.46
514 0.47
515 0.46
516 0.44
517 0.48
518 0.48
519 0.5
520 0.55
521 0.56
522 0.62
523 0.58
524 0.58
525 0.58
526 0.58
527 0.51
528 0.44
529 0.37
530 0.3
531 0.27
532 0.26
533 0.19
534 0.16
535 0.16
536 0.15
537 0.13
538 0.11
539 0.11
540 0.11
541 0.11
542 0.11
543 0.12
544 0.14
545 0.16
546 0.19
547 0.22
548 0.23
549 0.23
550 0.26
551 0.26
552 0.27
553 0.27
554 0.25
555 0.24
556 0.25
557 0.27
558 0.26
559 0.28
560 0.24
561 0.24
562 0.24
563 0.24
564 0.23
565 0.21
566 0.21
567 0.19
568 0.2
569 0.23
570 0.24
571 0.24
572 0.25
573 0.26
574 0.28
575 0.28
576 0.27
577 0.25
578 0.25
579 0.23
580 0.21
581 0.19
582 0.17
583 0.2
584 0.27
585 0.31
586 0.34
587 0.36
588 0.43
589 0.47
590 0.47
591 0.45
592 0.39
593 0.34
594 0.31
595 0.3
596 0.24
597 0.27
598 0.27
599 0.29
600 0.32
601 0.31
602 0.31
603 0.34
604 0.33
605 0.3
606 0.34
607 0.31
608 0.32
609 0.33
610 0.34
611 0.3
612 0.28
613 0.26
614 0.2
615 0.17
616 0.13
617 0.11
618 0.07
619 0.09
620 0.09
621 0.08
622 0.08
623 0.09
624 0.1
625 0.12
626 0.16
627 0.15
628 0.16
629 0.17
630 0.16
631 0.15
632 0.15
633 0.12
634 0.08
635 0.07
636 0.06
637 0.05
638 0.05
639 0.05
640 0.04
641 0.04
642 0.04
643 0.05
644 0.04
645 0.06
646 0.08
647 0.11
648 0.18
649 0.21