Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2Z961

Protein Details
Accession M2Z961   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
187-209KLDEKKAKEREQRREQERKEREQBasic
NLS Segment(s)
PositionSequence
128-146QRNVGAKKAKALARRDQRR
172-206KAQSIERERRKAVEAKLDEKKAKEREQRREQERKE
Subcellular Location(s) cyto 13.5, cyto_nucl 10, mito 6, nucl 5.5
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_84477  -  
Amino Acid Sequences MTSLVSFLNRLLPFATPGTPLVQDLLHLGVICSLLYFAPQIQEYVQRRHLNPSIPEQPPVGQDDDGPEVPSADEQVADQHDPDPTHQDNGVGEPVNVNEDDFNGAVNGDLDGPANRVPVAGPANGRPQRNVGAKKAKALARRDQRRAYHEFQRSQGEAQRAKDAEGASEREKAQSIERERRKAVEAKLDEKKAKEREQRREQERKEREQEMQRREQAIDLVREQLQERQMSNVFEVARQVGGDADDVWLEKILKAAGVLGKNADDSITIATSLGWIVRVQRQDMLKAYEKAAAAKHSDDGEISYEDLGTHLEAVLREKVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.17
4 0.18
5 0.2
6 0.19
7 0.19
8 0.17
9 0.15
10 0.13
11 0.13
12 0.13
13 0.11
14 0.1
15 0.09
16 0.09
17 0.09
18 0.09
19 0.07
20 0.06
21 0.05
22 0.06
23 0.07
24 0.07
25 0.09
26 0.1
27 0.11
28 0.12
29 0.21
30 0.25
31 0.31
32 0.39
33 0.43
34 0.44
35 0.51
36 0.54
37 0.52
38 0.51
39 0.53
40 0.53
41 0.49
42 0.49
43 0.43
44 0.4
45 0.35
46 0.34
47 0.28
48 0.19
49 0.18
50 0.19
51 0.22
52 0.21
53 0.2
54 0.16
55 0.14
56 0.14
57 0.14
58 0.12
59 0.08
60 0.07
61 0.06
62 0.09
63 0.11
64 0.11
65 0.12
66 0.11
67 0.14
68 0.14
69 0.16
70 0.19
71 0.18
72 0.2
73 0.2
74 0.2
75 0.18
76 0.19
77 0.21
78 0.15
79 0.14
80 0.12
81 0.12
82 0.12
83 0.12
84 0.1
85 0.07
86 0.07
87 0.08
88 0.08
89 0.07
90 0.06
91 0.06
92 0.06
93 0.06
94 0.05
95 0.04
96 0.04
97 0.05
98 0.05
99 0.06
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.1
106 0.11
107 0.12
108 0.12
109 0.14
110 0.24
111 0.28
112 0.29
113 0.26
114 0.27
115 0.32
116 0.38
117 0.4
118 0.38
119 0.43
120 0.44
121 0.46
122 0.49
123 0.47
124 0.45
125 0.47
126 0.48
127 0.49
128 0.57
129 0.6
130 0.61
131 0.62
132 0.61
133 0.63
134 0.59
135 0.57
136 0.56
137 0.52
138 0.48
139 0.48
140 0.43
141 0.38
142 0.37
143 0.34
144 0.29
145 0.28
146 0.3
147 0.25
148 0.25
149 0.26
150 0.22
151 0.17
152 0.16
153 0.18
154 0.15
155 0.18
156 0.17
157 0.15
158 0.16
159 0.16
160 0.17
161 0.21
162 0.26
163 0.33
164 0.39
165 0.43
166 0.43
167 0.44
168 0.45
169 0.44
170 0.4
171 0.4
172 0.37
173 0.39
174 0.45
175 0.47
176 0.46
177 0.42
178 0.46
179 0.43
180 0.49
181 0.51
182 0.55
183 0.61
184 0.69
185 0.77
186 0.79
187 0.83
188 0.8
189 0.82
190 0.8
191 0.79
192 0.74
193 0.68
194 0.66
195 0.65
196 0.68
197 0.65
198 0.65
199 0.6
200 0.56
201 0.53
202 0.47
203 0.41
204 0.36
205 0.31
206 0.24
207 0.23
208 0.21
209 0.22
210 0.22
211 0.22
212 0.21
213 0.21
214 0.21
215 0.22
216 0.23
217 0.23
218 0.23
219 0.23
220 0.19
221 0.17
222 0.18
223 0.14
224 0.12
225 0.11
226 0.1
227 0.07
228 0.07
229 0.07
230 0.07
231 0.06
232 0.06
233 0.07
234 0.07
235 0.08
236 0.08
237 0.07
238 0.08
239 0.08
240 0.08
241 0.08
242 0.1
243 0.13
244 0.13
245 0.14
246 0.14
247 0.14
248 0.14
249 0.14
250 0.12
251 0.08
252 0.08
253 0.09
254 0.08
255 0.08
256 0.08
257 0.08
258 0.08
259 0.08
260 0.07
261 0.06
262 0.06
263 0.1
264 0.15
265 0.18
266 0.19
267 0.24
268 0.26
269 0.3
270 0.34
271 0.37
272 0.38
273 0.38
274 0.38
275 0.37
276 0.36
277 0.34
278 0.33
279 0.3
280 0.26
281 0.25
282 0.26
283 0.23
284 0.23
285 0.21
286 0.2
287 0.19
288 0.17
289 0.16
290 0.14
291 0.12
292 0.12
293 0.12
294 0.11
295 0.08
296 0.07
297 0.07
298 0.09
299 0.1
300 0.13