Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3B7L4

Protein Details
Accession M3B7L4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGGKKQKKKWSKGKVKDKANHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 12, nucl 9, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG pfj:MYCFIDRAFT_60199  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGGKKQKKKWSKGKVKDKANHAVVLDKNTNEKLQKDVQSYRLITVAVLVDRLKINGSLARKALNDLEERGVIKKVVAHSAGNIYTRAVGGASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.88
9 0.85
10 0.83
11 0.74
12 0.66
13 0.55
14 0.52
15 0.43
16 0.41
17 0.36
18 0.27
19 0.26
20 0.25
21 0.27
22 0.23
23 0.22
24 0.21
25 0.25
26 0.29
27 0.31
28 0.33
29 0.34
30 0.36
31 0.36
32 0.32
33 0.27
34 0.22
35 0.17
36 0.15
37 0.12
38 0.07
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.06
46 0.07
47 0.1
48 0.13
49 0.14
50 0.15
51 0.17
52 0.17
53 0.18
54 0.19
55 0.19
56 0.19
57 0.18
58 0.19
59 0.18
60 0.19
61 0.19
62 0.18
63 0.15
64 0.14
65 0.15
66 0.15
67 0.19
68 0.2
69 0.19
70 0.2
71 0.24
72 0.26
73 0.24
74 0.23
75 0.18
76 0.17
77 0.17
78 0.15