Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2ZXI3

Protein Details
Accession M2ZXI3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
23-48QDSIDDRRIWKKKKTNKQPVLNEFIPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 12.332, cyto_nucl 10.333, mito 9.5
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_205576  -  
Amino Acid Sequences MSLHLRLSRSIPSHRRERASEIQDSIDDRRIWKKKKTNKQPVLNEFIPRGIRDNVGSTFSDPNGGVTSASESLPWHLAFESPSNFKPVIKHLLGHDTTHASITSSFAINLRPASCASYTRNCAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.64
3 0.61
4 0.65
5 0.65
6 0.62
7 0.6
8 0.52
9 0.47
10 0.43
11 0.41
12 0.36
13 0.32
14 0.27
15 0.24
16 0.32
17 0.39
18 0.44
19 0.51
20 0.58
21 0.63
22 0.73
23 0.82
24 0.84
25 0.85
26 0.89
27 0.9
28 0.86
29 0.84
30 0.74
31 0.65
32 0.54
33 0.47
34 0.38
35 0.28
36 0.25
37 0.18
38 0.17
39 0.16
40 0.18
41 0.15
42 0.16
43 0.16
44 0.15
45 0.15
46 0.14
47 0.14
48 0.11
49 0.11
50 0.09
51 0.09
52 0.07
53 0.06
54 0.08
55 0.08
56 0.08
57 0.07
58 0.07
59 0.08
60 0.1
61 0.1
62 0.09
63 0.08
64 0.08
65 0.09
66 0.12
67 0.14
68 0.15
69 0.16
70 0.18
71 0.19
72 0.19
73 0.2
74 0.22
75 0.27
76 0.24
77 0.26
78 0.25
79 0.33
80 0.33
81 0.32
82 0.29
83 0.24
84 0.24
85 0.23
86 0.21
87 0.14
88 0.13
89 0.14
90 0.13
91 0.11
92 0.11
93 0.11
94 0.13
95 0.14
96 0.16
97 0.15
98 0.15
99 0.15
100 0.18
101 0.19
102 0.22
103 0.26
104 0.32