Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2Z935

Protein Details
Accession M2Z935   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-73VRQKSQKAKTKMSRSNRPRKEPQIHydrophilic
NLS Segment(s)
PositionSequence
30-70PPKIPPPVPPKSPKPSVREIVRQKSQKAKTKMSRSNRPRKE
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_202458  -  
Amino Acid Sequences MSKLGVHRETVEERAHLSPSPPPRASVPLPPKIPPPVPPKSPKPSVREIVRQKSQKAKTKMSRSNRPRKEPQIVRQESVRDKGISRPLPHIVSQVSSGIPPKNRPSSNTDVNLPLMSVDSRRRRSPDWTGTGSKTRSHRQPGGMRTFYDDTPSPRPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.23
4 0.22
5 0.24
6 0.3
7 0.38
8 0.35
9 0.35
10 0.36
11 0.42
12 0.43
13 0.47
14 0.47
15 0.46
16 0.48
17 0.48
18 0.49
19 0.49
20 0.48
21 0.45
22 0.45
23 0.44
24 0.49
25 0.54
26 0.59
27 0.6
28 0.68
29 0.67
30 0.65
31 0.65
32 0.66
33 0.65
34 0.66
35 0.68
36 0.67
37 0.69
38 0.67
39 0.64
40 0.66
41 0.68
42 0.68
43 0.65
44 0.66
45 0.67
46 0.73
47 0.78
48 0.77
49 0.8
50 0.81
51 0.85
52 0.83
53 0.82
54 0.8
55 0.79
56 0.8
57 0.76
58 0.74
59 0.75
60 0.68
61 0.61
62 0.55
63 0.52
64 0.44
65 0.39
66 0.33
67 0.22
68 0.2
69 0.24
70 0.29
71 0.29
72 0.29
73 0.3
74 0.31
75 0.32
76 0.31
77 0.29
78 0.22
79 0.18
80 0.17
81 0.15
82 0.12
83 0.11
84 0.12
85 0.14
86 0.15
87 0.18
88 0.23
89 0.31
90 0.32
91 0.34
92 0.4
93 0.44
94 0.49
95 0.48
96 0.45
97 0.38
98 0.38
99 0.35
100 0.27
101 0.2
102 0.13
103 0.11
104 0.12
105 0.18
106 0.26
107 0.31
108 0.35
109 0.4
110 0.42
111 0.49
112 0.57
113 0.58
114 0.56
115 0.58
116 0.58
117 0.58
118 0.62
119 0.56
120 0.52
121 0.49
122 0.5
123 0.53
124 0.57
125 0.58
126 0.6
127 0.67
128 0.71
129 0.74
130 0.69
131 0.61
132 0.59
133 0.56
134 0.47
135 0.44
136 0.38
137 0.34