Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3AIA7

Protein Details
Accession M3AIA7   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
39-59PSTRLSRPPLQRPQKPGKKASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 6, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016939  Mt__Rbsml_prot_S25  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG pfj:MYCFIDRAFT_187371  -  
Pfam View protein in Pfam  
PF13741  MRP-S25  
Amino Acid Sequences MGRYNFAPQNVHKQATLLLDAKRMPAPPPWYPVIGKIPPSTRLSRPPLQRPQKPGKKASQLFKPVSLQYAEDRLRWEYYNDHPWELARPRVVLEDDGRDRERWDWSLPLDYNLRRPKVGYTDEFGNDHRGWDRVMQKQSARPINGESVIQRWQYLLTHTELSSPAAYDVARKELYRNRHYKEVQLRVAKEEAQATGAYFGLGPLEVGELLEDRAFENWKLWAVKETQALRALAGAAYSGVDETSAVETQEPEQAELQTARGGAADRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.37
4 0.3
5 0.25
6 0.27
7 0.28
8 0.3
9 0.29
10 0.27
11 0.24
12 0.27
13 0.32
14 0.33
15 0.37
16 0.37
17 0.38
18 0.38
19 0.41
20 0.42
21 0.4
22 0.39
23 0.39
24 0.39
25 0.41
26 0.45
27 0.45
28 0.41
29 0.46
30 0.5
31 0.53
32 0.58
33 0.63
34 0.69
35 0.74
36 0.76
37 0.76
38 0.8
39 0.82
40 0.81
41 0.79
42 0.77
43 0.78
44 0.78
45 0.76
46 0.75
47 0.74
48 0.68
49 0.64
50 0.59
51 0.49
52 0.44
53 0.38
54 0.3
55 0.23
56 0.29
57 0.26
58 0.23
59 0.25
60 0.24
61 0.25
62 0.25
63 0.24
64 0.2
65 0.24
66 0.32
67 0.32
68 0.3
69 0.28
70 0.28
71 0.33
72 0.32
73 0.3
74 0.22
75 0.2
76 0.2
77 0.22
78 0.23
79 0.19
80 0.17
81 0.2
82 0.21
83 0.24
84 0.25
85 0.23
86 0.24
87 0.23
88 0.24
89 0.2
90 0.2
91 0.18
92 0.18
93 0.22
94 0.22
95 0.22
96 0.24
97 0.23
98 0.29
99 0.33
100 0.33
101 0.28
102 0.29
103 0.29
104 0.3
105 0.33
106 0.27
107 0.24
108 0.26
109 0.27
110 0.27
111 0.25
112 0.24
113 0.2
114 0.19
115 0.16
116 0.14
117 0.13
118 0.17
119 0.21
120 0.23
121 0.26
122 0.28
123 0.29
124 0.32
125 0.38
126 0.38
127 0.34
128 0.28
129 0.28
130 0.27
131 0.26
132 0.23
133 0.17
134 0.14
135 0.16
136 0.15
137 0.13
138 0.12
139 0.12
140 0.11
141 0.12
142 0.12
143 0.11
144 0.12
145 0.12
146 0.14
147 0.13
148 0.14
149 0.13
150 0.11
151 0.09
152 0.08
153 0.08
154 0.09
155 0.09
156 0.12
157 0.13
158 0.13
159 0.17
160 0.22
161 0.31
162 0.38
163 0.45
164 0.45
165 0.53
166 0.54
167 0.58
168 0.62
169 0.62
170 0.61
171 0.59
172 0.56
173 0.51
174 0.51
175 0.44
176 0.36
177 0.29
178 0.21
179 0.16
180 0.15
181 0.12
182 0.11
183 0.1
184 0.08
185 0.07
186 0.06
187 0.05
188 0.05
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.05
195 0.05
196 0.05
197 0.06
198 0.06
199 0.06
200 0.07
201 0.1
202 0.1
203 0.1
204 0.11
205 0.16
206 0.17
207 0.17
208 0.19
209 0.2
210 0.25
211 0.31
212 0.32
213 0.32
214 0.35
215 0.34
216 0.3
217 0.28
218 0.24
219 0.17
220 0.14
221 0.1
222 0.06
223 0.06
224 0.06
225 0.05
226 0.04
227 0.04
228 0.04
229 0.06
230 0.08
231 0.09
232 0.09
233 0.1
234 0.11
235 0.12
236 0.17
237 0.16
238 0.15
239 0.16
240 0.17
241 0.2
242 0.19
243 0.19
244 0.16
245 0.16
246 0.14
247 0.13