Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3B4W4

Protein Details
Accession M3B4W4   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
15-42LLWKIPWRLSRHQKARQRQRLRRVDNIVHydrophilic
83-102KKVRGYRKGVHKLPKWTRVSBasic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG pfj:MYCFIDRAFT_163223  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPTAPLSGGLLWKIPWRLSRHQKARQRQRLRRVDNIVARLLRDVAAEHGTTKLIERWKAEMPTEGEMLAKDKYTMFDKKVRGYRKGVHKLPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.19
5 0.19
6 0.2
7 0.23
8 0.28
9 0.38
10 0.48
11 0.58
12 0.64
13 0.72
14 0.78
15 0.83
16 0.88
17 0.89
18 0.9
19 0.88
20 0.89
21 0.9
22 0.86
23 0.84
24 0.79
25 0.76
26 0.7
27 0.64
28 0.56
29 0.46
30 0.4
31 0.32
32 0.25
33 0.18
34 0.13
35 0.1
36 0.08
37 0.09
38 0.09
39 0.08
40 0.08
41 0.08
42 0.08
43 0.08
44 0.1
45 0.11
46 0.14
47 0.15
48 0.18
49 0.21
50 0.23
51 0.23
52 0.24
53 0.23
54 0.23
55 0.22
56 0.18
57 0.15
58 0.14
59 0.15
60 0.11
61 0.09
62 0.08
63 0.08
64 0.1
65 0.15
66 0.19
67 0.21
68 0.27
69 0.31
70 0.39
71 0.47
72 0.51
73 0.52
74 0.54
75 0.59
76 0.63
77 0.69
78 0.69
79 0.71
80 0.72
81 0.77
82 0.8
83 0.82
84 0.77
85 0.75
86 0.77
87 0.78
88 0.8
89 0.77
90 0.79