Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3B2R1

Protein Details
Accession M3B2R1    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
38-59QHTPQQRTLRRLRSKTHRIAGKHydrophilic
78-106ILRPKIATPQKLKKTRKPRRVPSPAMNAQHydrophilic
NLS Segment(s)
PositionSequence
85-98TPQKLKKTRKPRRV
Subcellular Location(s) nucl 13, mito 9, cyto 3
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_175081  -  
Amino Acid Sequences MSWVCAEKEFATWTVRSGSRTAQHKRTFQGLPPRSLVQHTPQQRTLRRLRSKTHRIAGKLIGSSYGAAILTASRTTSILRPKIATPQKLKKTRKPRRVPSPAMNAQPGPTAAARVFDTPELAEMIFLHLPLKNLCVAMQINKKSYQIINNPSSKEMRQNRYLDAVPNDTTTFLDPNTEKVFKPTCKDWIAFHPFLERLFHRSSVSIRELAETFVPESVQEQLIVQPYQRNMYFYSYDPRDYWPGRGSWCTMAQGKSGGKIKTLVKHAKKHVEMRGDAADNLVMLHFDPPWLGVAGGLNRWAYDREIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.27
4 0.26
5 0.31
6 0.34
7 0.44
8 0.5
9 0.54
10 0.6
11 0.63
12 0.65
13 0.65
14 0.61
15 0.59
16 0.62
17 0.58
18 0.55
19 0.54
20 0.53
21 0.47
22 0.47
23 0.43
24 0.38
25 0.41
26 0.44
27 0.47
28 0.52
29 0.59
30 0.62
31 0.66
32 0.7
33 0.72
34 0.74
35 0.73
36 0.76
37 0.78
38 0.82
39 0.83
40 0.82
41 0.78
42 0.71
43 0.69
44 0.65
45 0.59
46 0.5
47 0.41
48 0.34
49 0.27
50 0.24
51 0.19
52 0.14
53 0.09
54 0.07
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.09
63 0.13
64 0.21
65 0.24
66 0.26
67 0.28
68 0.29
69 0.39
70 0.45
71 0.48
72 0.48
73 0.55
74 0.63
75 0.71
76 0.78
77 0.78
78 0.82
79 0.85
80 0.87
81 0.87
82 0.88
83 0.88
84 0.91
85 0.89
86 0.86
87 0.85
88 0.8
89 0.72
90 0.64
91 0.53
92 0.43
93 0.36
94 0.28
95 0.2
96 0.14
97 0.12
98 0.09
99 0.11
100 0.11
101 0.11
102 0.12
103 0.1
104 0.1
105 0.09
106 0.09
107 0.08
108 0.07
109 0.06
110 0.05
111 0.07
112 0.07
113 0.07
114 0.07
115 0.07
116 0.08
117 0.09
118 0.1
119 0.08
120 0.08
121 0.08
122 0.1
123 0.1
124 0.15
125 0.22
126 0.23
127 0.24
128 0.26
129 0.26
130 0.26
131 0.27
132 0.27
133 0.26
134 0.31
135 0.35
136 0.37
137 0.37
138 0.37
139 0.38
140 0.32
141 0.35
142 0.36
143 0.35
144 0.38
145 0.39
146 0.39
147 0.4
148 0.41
149 0.34
150 0.29
151 0.27
152 0.2
153 0.19
154 0.18
155 0.15
156 0.14
157 0.12
158 0.11
159 0.08
160 0.1
161 0.09
162 0.12
163 0.16
164 0.18
165 0.17
166 0.2
167 0.26
168 0.26
169 0.3
170 0.29
171 0.32
172 0.33
173 0.34
174 0.32
175 0.36
176 0.42
177 0.38
178 0.36
179 0.33
180 0.3
181 0.29
182 0.3
183 0.22
184 0.19
185 0.2
186 0.22
187 0.19
188 0.2
189 0.21
190 0.24
191 0.25
192 0.22
193 0.2
194 0.21
195 0.2
196 0.2
197 0.19
198 0.14
199 0.12
200 0.1
201 0.1
202 0.08
203 0.08
204 0.09
205 0.09
206 0.08
207 0.08
208 0.1
209 0.13
210 0.13
211 0.13
212 0.15
213 0.16
214 0.2
215 0.2
216 0.2
217 0.19
218 0.23
219 0.24
220 0.23
221 0.3
222 0.28
223 0.3
224 0.29
225 0.31
226 0.34
227 0.33
228 0.35
229 0.3
230 0.31
231 0.31
232 0.33
233 0.32
234 0.29
235 0.3
236 0.3
237 0.31
238 0.3
239 0.27
240 0.3
241 0.28
242 0.3
243 0.34
244 0.31
245 0.28
246 0.32
247 0.35
248 0.37
249 0.45
250 0.5
251 0.52
252 0.6
253 0.68
254 0.73
255 0.75
256 0.76
257 0.74
258 0.72
259 0.65
260 0.6
261 0.58
262 0.5
263 0.43
264 0.36
265 0.28
266 0.2
267 0.19
268 0.14
269 0.08
270 0.06
271 0.07
272 0.06
273 0.06
274 0.07
275 0.07
276 0.09
277 0.09
278 0.09
279 0.08
280 0.12
281 0.14
282 0.15
283 0.17
284 0.15
285 0.15
286 0.17
287 0.18