Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3ACY8

Protein Details
Accession M3ACY8    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
234-264GSTERMKLQLKRCRRQKKFRHAVIHRRHGFSBasic
NLS Segment(s)
PositionSequence
247-255RRQKKFRHA
Subcellular Location(s) nucl 12, mito 8, cyto 6
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_175956  -  
Amino Acid Sequences MKSQYARNLEVDSSGSSNRSVSIFHHNHKTYYGNDIAAIQQNLWLVECRLETQPKVMVANLTLRQRKQVISPIPLQEMAAMRKLCRFTTPGCPDFDPPNAAAVATATDIEIGNGSGRVRREEEREPLRVREEAENEGGDTSRNLRVMVKFKHVFISLQNSIAAAHRIASGIILPKKIHTRFAKIPSFRSSHQAVKIIDSHSFSFPSKDNGEPPPPPPPPTRYPSPNKLLNRSQGSTERMKLQLKRCRRQKKFRHAVIHRRHGFSPRHYQRLLVLRPSPGRAGGPMVDFLTGLPVLRSGACMFCAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.17
4 0.17
5 0.17
6 0.15
7 0.14
8 0.15
9 0.24
10 0.3
11 0.34
12 0.44
13 0.45
14 0.45
15 0.47
16 0.48
17 0.38
18 0.39
19 0.36
20 0.26
21 0.25
22 0.25
23 0.25
24 0.26
25 0.25
26 0.18
27 0.17
28 0.17
29 0.17
30 0.17
31 0.15
32 0.11
33 0.12
34 0.13
35 0.14
36 0.18
37 0.22
38 0.22
39 0.23
40 0.27
41 0.26
42 0.27
43 0.25
44 0.21
45 0.19
46 0.25
47 0.26
48 0.31
49 0.34
50 0.33
51 0.37
52 0.39
53 0.39
54 0.36
55 0.41
56 0.39
57 0.39
58 0.44
59 0.42
60 0.42
61 0.41
62 0.36
63 0.29
64 0.26
65 0.23
66 0.23
67 0.2
68 0.19
69 0.23
70 0.25
71 0.23
72 0.22
73 0.23
74 0.21
75 0.31
76 0.39
77 0.37
78 0.39
79 0.4
80 0.4
81 0.4
82 0.39
83 0.31
84 0.23
85 0.22
86 0.18
87 0.16
88 0.13
89 0.1
90 0.09
91 0.06
92 0.06
93 0.04
94 0.05
95 0.05
96 0.05
97 0.05
98 0.04
99 0.04
100 0.05
101 0.06
102 0.08
103 0.09
104 0.11
105 0.14
106 0.16
107 0.21
108 0.25
109 0.33
110 0.36
111 0.41
112 0.41
113 0.4
114 0.4
115 0.36
116 0.33
117 0.29
118 0.27
119 0.23
120 0.22
121 0.2
122 0.18
123 0.17
124 0.14
125 0.1
126 0.08
127 0.08
128 0.09
129 0.09
130 0.09
131 0.11
132 0.15
133 0.21
134 0.23
135 0.29
136 0.28
137 0.28
138 0.3
139 0.29
140 0.26
141 0.21
142 0.26
143 0.19
144 0.18
145 0.18
146 0.15
147 0.15
148 0.15
149 0.14
150 0.07
151 0.06
152 0.06
153 0.06
154 0.06
155 0.05
156 0.06
157 0.1
158 0.12
159 0.13
160 0.13
161 0.15
162 0.22
163 0.23
164 0.3
165 0.28
166 0.34
167 0.4
168 0.48
169 0.54
170 0.49
171 0.52
172 0.49
173 0.5
174 0.44
175 0.41
176 0.37
177 0.34
178 0.35
179 0.37
180 0.32
181 0.31
182 0.33
183 0.3
184 0.28
185 0.25
186 0.24
187 0.19
188 0.21
189 0.18
190 0.18
191 0.17
192 0.2
193 0.2
194 0.2
195 0.23
196 0.26
197 0.31
198 0.3
199 0.32
200 0.36
201 0.36
202 0.38
203 0.39
204 0.4
205 0.41
206 0.45
207 0.5
208 0.49
209 0.56
210 0.6
211 0.62
212 0.65
213 0.64
214 0.65
215 0.64
216 0.64
217 0.62
218 0.56
219 0.53
220 0.5
221 0.5
222 0.47
223 0.43
224 0.4
225 0.39
226 0.43
227 0.46
228 0.5
229 0.55
230 0.6
231 0.68
232 0.74
233 0.8
234 0.84
235 0.88
236 0.9
237 0.92
238 0.92
239 0.92
240 0.92
241 0.91
242 0.91
243 0.91
244 0.91
245 0.86
246 0.79
247 0.72
248 0.69
249 0.66
250 0.62
251 0.63
252 0.61
253 0.62
254 0.58
255 0.57
256 0.56
257 0.59
258 0.57
259 0.53
260 0.48
261 0.47
262 0.5
263 0.52
264 0.46
265 0.38
266 0.34
267 0.28
268 0.28
269 0.24
270 0.22
271 0.21
272 0.2
273 0.18
274 0.17
275 0.15
276 0.15
277 0.12
278 0.11
279 0.09
280 0.09
281 0.1
282 0.1
283 0.12
284 0.11
285 0.12