Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3A596

Protein Details
Accession M3A596   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
42-63RQSPTMARKKEKRRISKENLALHydrophilic
NLS Segment(s)
PositionSequence
49-56RKKEKRRI
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR038291  SAP30_C_sf  
KEGG pfj:MYCFIDRAFT_124978  -  
Amino Acid Sequences MAWQSAPLSLLNQYRVAHNIQTPPAFSTPYRQAILTNPGIGRQSPTMARKKEKRRISKENLALAVRKNFNGAAVNEIDVVVELVYKVRNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.26
4 0.24
5 0.24
6 0.26
7 0.27
8 0.27
9 0.26
10 0.27
11 0.25
12 0.24
13 0.21
14 0.23
15 0.25
16 0.28
17 0.28
18 0.25
19 0.25
20 0.26
21 0.31
22 0.26
23 0.23
24 0.18
25 0.18
26 0.19
27 0.18
28 0.17
29 0.11
30 0.12
31 0.13
32 0.19
33 0.25
34 0.29
35 0.36
36 0.44
37 0.53
38 0.61
39 0.67
40 0.72
41 0.74
42 0.8
43 0.82
44 0.83
45 0.79
46 0.75
47 0.7
48 0.6
49 0.53
50 0.46
51 0.44
52 0.36
53 0.29
54 0.25
55 0.22
56 0.22
57 0.24
58 0.21
59 0.18
60 0.17
61 0.18
62 0.16
63 0.16
64 0.14
65 0.1
66 0.1
67 0.06
68 0.05
69 0.04
70 0.06