Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1Q680

Protein Details
Accession N1Q680    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
195-224MERKVNKRMAESRKAKKEAKERRRAEREGGBasic
NLS Segment(s)
PositionSequence
197-224RKVNKRMAESRKAKKEAKERRRAEREGG
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_75558  -  
Amino Acid Sequences MSMSTGNAPTAGAPTPPQEEQPNGAYASYVPHDLKYHADFEDSLMQPVLNGPSNQDGIRVIPEGSADIPVEGVSVRAQDISIESLPSISEEELPLPLDDPRRQFASPVPGIKLTHPGGYLEGGPGLDPDMDTFAEDFFDRNRHVTTSEDMRAAIQREIDENKELLQERLRARQEAKEKNERIEKELKLMQEEHEMERKVNKRMAESRKAKKEAKERRRAEREGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.19
3 0.2
4 0.23
5 0.25
6 0.26
7 0.29
8 0.3
9 0.29
10 0.25
11 0.24
12 0.21
13 0.17
14 0.18
15 0.16
16 0.17
17 0.15
18 0.16
19 0.18
20 0.19
21 0.23
22 0.22
23 0.23
24 0.2
25 0.21
26 0.19
27 0.2
28 0.28
29 0.24
30 0.22
31 0.2
32 0.19
33 0.17
34 0.19
35 0.19
36 0.12
37 0.12
38 0.13
39 0.15
40 0.17
41 0.17
42 0.17
43 0.14
44 0.13
45 0.15
46 0.14
47 0.11
48 0.1
49 0.1
50 0.1
51 0.09
52 0.1
53 0.08
54 0.07
55 0.06
56 0.06
57 0.06
58 0.05
59 0.05
60 0.04
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.08
68 0.08
69 0.08
70 0.08
71 0.08
72 0.08
73 0.08
74 0.08
75 0.05
76 0.06
77 0.06
78 0.07
79 0.07
80 0.08
81 0.07
82 0.07
83 0.08
84 0.11
85 0.14
86 0.15
87 0.17
88 0.19
89 0.19
90 0.2
91 0.21
92 0.25
93 0.25
94 0.25
95 0.24
96 0.23
97 0.24
98 0.23
99 0.26
100 0.19
101 0.17
102 0.16
103 0.15
104 0.13
105 0.13
106 0.13
107 0.08
108 0.07
109 0.06
110 0.05
111 0.05
112 0.05
113 0.04
114 0.04
115 0.04
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.06
122 0.06
123 0.06
124 0.06
125 0.09
126 0.09
127 0.11
128 0.12
129 0.12
130 0.13
131 0.15
132 0.18
133 0.21
134 0.22
135 0.21
136 0.2
137 0.2
138 0.22
139 0.22
140 0.19
141 0.14
142 0.13
143 0.15
144 0.17
145 0.18
146 0.18
147 0.16
148 0.16
149 0.19
150 0.19
151 0.18
152 0.19
153 0.23
154 0.25
155 0.33
156 0.35
157 0.34
158 0.36
159 0.42
160 0.48
161 0.52
162 0.56
163 0.58
164 0.58
165 0.62
166 0.68
167 0.63
168 0.59
169 0.57
170 0.51
171 0.47
172 0.48
173 0.42
174 0.37
175 0.37
176 0.32
177 0.32
178 0.34
179 0.31
180 0.34
181 0.34
182 0.31
183 0.39
184 0.42
185 0.4
186 0.42
187 0.4
188 0.42
189 0.5
190 0.59
191 0.61
192 0.66
193 0.7
194 0.76
195 0.82
196 0.79
197 0.79
198 0.8
199 0.81
200 0.82
201 0.83
202 0.8
203 0.84
204 0.87