Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3B9J8

Protein Details
Accession M3B9J8    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
279-298GYHKDRSNAKQAKKFKGYCCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto 7, mito_nucl 7
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_206668  -  
Amino Acid Sequences MYPEPRGIGDMTLEIMTCNKAATSWIRRTGAFGYRLHPSARPAKRTWRFAESICTKMKLMIAITATSWALASRDYIYRLAGFPVRSFTLTHKCITYFREFLLVIRYLTIQSPAVDFFSCWLLDARSVSSSRAGRRVDKSRVLYTAIGDLNLVIRFFFQDLVSVKRVVHRLPLHRRSKGGASFVYSSPTIGRANSTSFFPDTQLHELHSVWMSRGEREQSRIGVLVRHASCSQYLTRLFHQSIRTNTSSQCFPTLICRQNQNSSTPGIPYKPAIYCACPGYHKDRSNAKQAKKFKGYCCWPPIFVTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.1
5 0.09
6 0.07
7 0.07
8 0.11
9 0.2
10 0.27
11 0.34
12 0.41
13 0.43
14 0.44
15 0.47
16 0.49
17 0.47
18 0.44
19 0.38
20 0.33
21 0.36
22 0.38
23 0.36
24 0.33
25 0.31
26 0.37
27 0.43
28 0.46
29 0.46
30 0.55
31 0.62
32 0.68
33 0.68
34 0.65
35 0.6
36 0.55
37 0.61
38 0.55
39 0.52
40 0.47
41 0.43
42 0.36
43 0.35
44 0.34
45 0.26
46 0.22
47 0.19
48 0.18
49 0.16
50 0.16
51 0.16
52 0.14
53 0.12
54 0.11
55 0.08
56 0.07
57 0.06
58 0.08
59 0.09
60 0.11
61 0.13
62 0.13
63 0.14
64 0.15
65 0.15
66 0.17
67 0.17
68 0.17
69 0.15
70 0.18
71 0.18
72 0.17
73 0.18
74 0.21
75 0.26
76 0.28
77 0.28
78 0.26
79 0.27
80 0.28
81 0.32
82 0.32
83 0.25
84 0.23
85 0.26
86 0.25
87 0.24
88 0.26
89 0.22
90 0.16
91 0.16
92 0.16
93 0.12
94 0.12
95 0.13
96 0.1
97 0.09
98 0.09
99 0.09
100 0.1
101 0.09
102 0.09
103 0.08
104 0.09
105 0.08
106 0.08
107 0.08
108 0.08
109 0.08
110 0.09
111 0.1
112 0.1
113 0.11
114 0.11
115 0.15
116 0.18
117 0.19
118 0.25
119 0.26
120 0.28
121 0.34
122 0.41
123 0.42
124 0.46
125 0.48
126 0.43
127 0.43
128 0.4
129 0.34
130 0.27
131 0.26
132 0.19
133 0.15
134 0.13
135 0.11
136 0.1
137 0.1
138 0.09
139 0.04
140 0.04
141 0.05
142 0.05
143 0.06
144 0.05
145 0.08
146 0.09
147 0.13
148 0.14
149 0.15
150 0.14
151 0.17
152 0.19
153 0.16
154 0.22
155 0.24
156 0.32
157 0.42
158 0.52
159 0.55
160 0.56
161 0.57
162 0.52
163 0.53
164 0.46
165 0.4
166 0.31
167 0.27
168 0.28
169 0.27
170 0.26
171 0.2
172 0.17
173 0.14
174 0.15
175 0.13
176 0.1
177 0.11
178 0.1
179 0.13
180 0.14
181 0.14
182 0.14
183 0.15
184 0.15
185 0.15
186 0.17
187 0.18
188 0.2
189 0.2
190 0.19
191 0.19
192 0.19
193 0.18
194 0.17
195 0.14
196 0.12
197 0.16
198 0.16
199 0.16
200 0.19
201 0.22
202 0.22
203 0.26
204 0.28
205 0.24
206 0.25
207 0.25
208 0.23
209 0.21
210 0.19
211 0.23
212 0.21
213 0.23
214 0.22
215 0.21
216 0.21
217 0.22
218 0.22
219 0.19
220 0.22
221 0.23
222 0.26
223 0.31
224 0.32
225 0.34
226 0.39
227 0.4
228 0.42
229 0.45
230 0.44
231 0.4
232 0.41
233 0.4
234 0.36
235 0.32
236 0.3
237 0.23
238 0.21
239 0.27
240 0.34
241 0.36
242 0.37
243 0.43
244 0.45
245 0.53
246 0.55
247 0.5
248 0.43
249 0.41
250 0.38
251 0.34
252 0.33
253 0.26
254 0.26
255 0.25
256 0.27
257 0.25
258 0.29
259 0.29
260 0.29
261 0.3
262 0.31
263 0.32
264 0.3
265 0.33
266 0.36
267 0.43
268 0.44
269 0.49
270 0.56
271 0.58
272 0.67
273 0.71
274 0.72
275 0.72
276 0.77
277 0.79
278 0.79
279 0.82
280 0.78
281 0.79
282 0.78
283 0.78
284 0.78
285 0.72
286 0.64