Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2Z0V5

Protein Details
Accession M2Z0V5    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-21LTKSHPPKSKDRGPKSEEDTBasic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto 7, cyto_nucl 7, pero 6, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036748  MTH938-like_sf  
IPR034095  NDUF3  
IPR007523  NDUFAF3/AAMDC  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005634  C:nucleus  
GO:0032981  P:mitochondrial respiratory chain complex I assembly  
KEGG pfj:MYCFIDRAFT_17662  -  
Pfam View protein in Pfam  
PF04430  DUF498  
CDD cd05125  Mth938_2P1-like  
Amino Acid Sequences ALTKSHPPKSKDRGPKSEEDTQTDFSAMNVLGNTPPPTTAVDACMDDGFALDSGLRVVGSGVLLVGGECFRWRPWVREGRAPSISGHLRNSKGQLDIPRHAWGILDLVWPKPDLLILGTGEKVIPLAPQTRKDINELGIRIEVQDTRNAAAQFNMLATERGTQQIAAALVPVGWKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.78
4 0.79
5 0.72
6 0.68
7 0.62
8 0.55
9 0.49
10 0.41
11 0.34
12 0.24
13 0.23
14 0.16
15 0.12
16 0.09
17 0.09
18 0.09
19 0.12
20 0.14
21 0.11
22 0.12
23 0.12
24 0.13
25 0.15
26 0.15
27 0.15
28 0.15
29 0.15
30 0.16
31 0.14
32 0.13
33 0.1
34 0.09
35 0.08
36 0.06
37 0.05
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.03
45 0.04
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.04
57 0.05
58 0.13
59 0.14
60 0.18
61 0.26
62 0.35
63 0.38
64 0.44
65 0.48
66 0.46
67 0.46
68 0.44
69 0.36
70 0.32
71 0.31
72 0.25
73 0.25
74 0.22
75 0.22
76 0.23
77 0.25
78 0.21
79 0.2
80 0.21
81 0.24
82 0.26
83 0.26
84 0.27
85 0.27
86 0.25
87 0.24
88 0.21
89 0.16
90 0.12
91 0.1
92 0.1
93 0.09
94 0.1
95 0.1
96 0.1
97 0.1
98 0.09
99 0.08
100 0.06
101 0.06
102 0.07
103 0.07
104 0.08
105 0.09
106 0.09
107 0.08
108 0.08
109 0.07
110 0.05
111 0.05
112 0.06
113 0.13
114 0.17
115 0.21
116 0.26
117 0.31
118 0.32
119 0.35
120 0.36
121 0.33
122 0.35
123 0.32
124 0.29
125 0.26
126 0.24
127 0.21
128 0.2
129 0.18
130 0.13
131 0.17
132 0.16
133 0.16
134 0.21
135 0.21
136 0.2
137 0.18
138 0.18
139 0.14
140 0.13
141 0.13
142 0.09
143 0.1
144 0.1
145 0.12
146 0.12
147 0.14
148 0.15
149 0.13
150 0.13
151 0.15
152 0.15
153 0.12
154 0.12
155 0.09
156 0.09