Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1QB23

Protein Details
Accession N1QB23    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
387-410VQMRGRSPTTKDGKRREMKRLSLLHydrophilic
NLS Segment(s)
PositionSequence
392-404RSPTTKDGKRREM
Subcellular Location(s) plas 15, mito 10
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG pfj:MYCFIDRAFT_205954  -  
Amino Acid Sequences MPDSTSFSARAAKSLVQLFLRHRYAYEGVPRVGRYVSRLELSLARLNVAEGLQKHGMYYGRYWIAMQVPGVAEFILVHAQCHLAIGASRASSARACKVYNFFISNVMPCVHGPLWRAASSAPRASALRPATHTHPQTLRSILRPPCHLISRNAAATPIRGASTEAAHARKKAVLYPERINVYRAGTSATLSVGLTRVATIIIFLAGATVYAPAYFFSPDHSSLWVPVYIAAAAVPFFVTALTTGPMIHAIRVYLPSRARRSKDDLKRFASLTPADTLLELQYMRWLPWPQTRRVPFGRLRRLQPSLRGGIANLEQQNPLVTDKLKNSLLGWLAHRNWGRFYVNRAQRNDRSAVPGVWEGMWGQIPLKGSKEDILMAQAESKKVKAPVQMRGRSPTTKDGKRREMKRLSLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.3
4 0.34
5 0.36
6 0.42
7 0.43
8 0.38
9 0.35
10 0.36
11 0.36
12 0.38
13 0.42
14 0.39
15 0.38
16 0.41
17 0.41
18 0.37
19 0.37
20 0.32
21 0.26
22 0.26
23 0.27
24 0.25
25 0.25
26 0.26
27 0.27
28 0.31
29 0.33
30 0.27
31 0.24
32 0.23
33 0.22
34 0.21
35 0.18
36 0.18
37 0.13
38 0.18
39 0.2
40 0.19
41 0.19
42 0.21
43 0.23
44 0.21
45 0.22
46 0.23
47 0.22
48 0.23
49 0.23
50 0.23
51 0.23
52 0.23
53 0.21
54 0.17
55 0.16
56 0.16
57 0.16
58 0.13
59 0.1
60 0.08
61 0.09
62 0.1
63 0.09
64 0.09
65 0.09
66 0.1
67 0.1
68 0.1
69 0.09
70 0.06
71 0.06
72 0.08
73 0.09
74 0.09
75 0.1
76 0.1
77 0.11
78 0.13
79 0.15
80 0.19
81 0.21
82 0.22
83 0.25
84 0.29
85 0.32
86 0.34
87 0.34
88 0.29
89 0.29
90 0.3
91 0.27
92 0.25
93 0.21
94 0.17
95 0.15
96 0.19
97 0.16
98 0.17
99 0.18
100 0.2
101 0.23
102 0.22
103 0.23
104 0.19
105 0.24
106 0.25
107 0.26
108 0.21
109 0.2
110 0.21
111 0.21
112 0.27
113 0.24
114 0.23
115 0.24
116 0.26
117 0.3
118 0.37
119 0.37
120 0.35
121 0.36
122 0.36
123 0.36
124 0.38
125 0.35
126 0.3
127 0.36
128 0.36
129 0.36
130 0.37
131 0.38
132 0.37
133 0.39
134 0.39
135 0.34
136 0.35
137 0.35
138 0.34
139 0.3
140 0.27
141 0.23
142 0.2
143 0.19
144 0.13
145 0.1
146 0.09
147 0.09
148 0.09
149 0.1
150 0.12
151 0.14
152 0.17
153 0.18
154 0.18
155 0.18
156 0.19
157 0.19
158 0.2
159 0.25
160 0.27
161 0.31
162 0.34
163 0.37
164 0.39
165 0.39
166 0.36
167 0.29
168 0.26
169 0.21
170 0.18
171 0.15
172 0.12
173 0.12
174 0.11
175 0.09
176 0.08
177 0.07
178 0.07
179 0.06
180 0.05
181 0.05
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.03
188 0.03
189 0.03
190 0.03
191 0.03
192 0.02
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.03
200 0.04
201 0.05
202 0.05
203 0.08
204 0.1
205 0.12
206 0.13
207 0.14
208 0.14
209 0.14
210 0.15
211 0.13
212 0.1
213 0.09
214 0.09
215 0.07
216 0.07
217 0.06
218 0.05
219 0.04
220 0.04
221 0.03
222 0.03
223 0.03
224 0.03
225 0.03
226 0.03
227 0.04
228 0.04
229 0.05
230 0.05
231 0.05
232 0.08
233 0.08
234 0.08
235 0.07
236 0.07
237 0.08
238 0.11
239 0.12
240 0.14
241 0.18
242 0.25
243 0.32
244 0.39
245 0.41
246 0.44
247 0.51
248 0.57
249 0.64
250 0.68
251 0.67
252 0.65
253 0.65
254 0.6
255 0.53
256 0.47
257 0.38
258 0.29
259 0.23
260 0.19
261 0.16
262 0.15
263 0.15
264 0.1
265 0.1
266 0.08
267 0.07
268 0.1
269 0.11
270 0.11
271 0.15
272 0.16
273 0.18
274 0.27
275 0.32
276 0.33
277 0.42
278 0.46
279 0.49
280 0.52
281 0.56
282 0.55
283 0.61
284 0.66
285 0.63
286 0.65
287 0.65
288 0.67
289 0.62
290 0.62
291 0.58
292 0.5
293 0.46
294 0.41
295 0.33
296 0.31
297 0.29
298 0.28
299 0.23
300 0.21
301 0.2
302 0.19
303 0.2
304 0.18
305 0.17
306 0.14
307 0.13
308 0.16
309 0.19
310 0.24
311 0.24
312 0.24
313 0.23
314 0.25
315 0.26
316 0.25
317 0.26
318 0.28
319 0.28
320 0.34
321 0.37
322 0.34
323 0.33
324 0.36
325 0.36
326 0.31
327 0.38
328 0.41
329 0.47
330 0.53
331 0.57
332 0.61
333 0.62
334 0.65
335 0.62
336 0.54
337 0.51
338 0.47
339 0.41
340 0.36
341 0.32
342 0.28
343 0.24
344 0.22
345 0.16
346 0.14
347 0.14
348 0.11
349 0.1
350 0.11
351 0.13
352 0.15
353 0.17
354 0.17
355 0.17
356 0.19
357 0.21
358 0.2
359 0.18
360 0.19
361 0.17
362 0.17
363 0.21
364 0.21
365 0.23
366 0.23
367 0.23
368 0.26
369 0.29
370 0.33
371 0.35
372 0.39
373 0.46
374 0.55
375 0.61
376 0.61
377 0.65
378 0.66
379 0.64
380 0.62
381 0.62
382 0.62
383 0.64
384 0.69
385 0.72
386 0.77
387 0.81
388 0.84
389 0.85
390 0.85