Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M3A4I9

Protein Details
Accession M3A4I9    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
99-121EEHVTAPPKKKPSKKPDTAAVADHydrophilic
NLS Segment(s)
PositionSequence
107-113KKKPSKK
Subcellular Location(s) nucl 15.5, mito_nucl 10, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007243  Atg6/Beclin  
IPR038274  Atg6/Beclin_C_sf  
IPR041691  Atg6/beclin_CC  
IPR040455  Atg6_BARA  
Gene Ontology GO:0006914  P:autophagy  
KEGG pfj:MYCFIDRAFT_156795  -  
Pfam View protein in Pfam  
PF04111  APG6  
PF17675  APG6_N  
Amino Acid Sequences MATLQCQKCKTPLKIDASLQHLNPASFKILADAAPVLEPKAPEAPRSAAAKERRQIYDDVSKQAGPPVHKRSVSASQRPGLHPDMSYIMLSEPQLASGEEHVTAPPKKKPSKKPDTAAVADGQTTLSQEMETTMRVFEILSARSDIDHPVCSECTELLLEGLQKRQASVSRERDAYVDFLKKAQQDMPTEEEKAKTKRDLEDAQRREKQALEELEALEAEKARMEDELAALDAEAEALDEEEEQFWRDRNAFAAELASFQEERDSLQVQLAHDSKVLEALQRTNVYNDTFCIGHDGTFGTINGLRLGRTPDQSVDWPEINAAWGQTLLLLTVVIEKLGIKLKGFELVPVGSTSKVVKVEYAQTASTPDGKPKKTVYELFSSGDLPLALNFLHRNFDNAMVAFLECLRQVGEHVERTTPKPGTPGLKMPYPIVKDKIGDVSIKLGSFGQDEQWTKACKYTLTCCKFLLAHASHMADSAETRNAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.72
3 0.69
4 0.66
5 0.64
6 0.54
7 0.51
8 0.45
9 0.38
10 0.34
11 0.3
12 0.26
13 0.21
14 0.21
15 0.17
16 0.16
17 0.16
18 0.17
19 0.15
20 0.13
21 0.13
22 0.14
23 0.13
24 0.13
25 0.13
26 0.14
27 0.21
28 0.22
29 0.22
30 0.26
31 0.28
32 0.31
33 0.35
34 0.35
35 0.35
36 0.43
37 0.5
38 0.51
39 0.55
40 0.53
41 0.52
42 0.52
43 0.5
44 0.52
45 0.48
46 0.47
47 0.42
48 0.39
49 0.37
50 0.39
51 0.37
52 0.32
53 0.37
54 0.4
55 0.45
56 0.45
57 0.46
58 0.48
59 0.54
60 0.58
61 0.58
62 0.57
63 0.55
64 0.59
65 0.59
66 0.58
67 0.51
68 0.44
69 0.35
70 0.31
71 0.28
72 0.24
73 0.22
74 0.17
75 0.14
76 0.14
77 0.13
78 0.13
79 0.11
80 0.1
81 0.11
82 0.11
83 0.11
84 0.11
85 0.12
86 0.1
87 0.11
88 0.11
89 0.16
90 0.19
91 0.23
92 0.27
93 0.36
94 0.44
95 0.54
96 0.64
97 0.7
98 0.77
99 0.82
100 0.82
101 0.82
102 0.81
103 0.73
104 0.65
105 0.56
106 0.45
107 0.36
108 0.3
109 0.21
110 0.13
111 0.11
112 0.09
113 0.07
114 0.06
115 0.06
116 0.07
117 0.08
118 0.08
119 0.08
120 0.08
121 0.08
122 0.08
123 0.08
124 0.09
125 0.11
126 0.11
127 0.12
128 0.13
129 0.13
130 0.14
131 0.15
132 0.15
133 0.13
134 0.14
135 0.14
136 0.15
137 0.15
138 0.15
139 0.15
140 0.12
141 0.11
142 0.1
143 0.09
144 0.07
145 0.07
146 0.09
147 0.1
148 0.11
149 0.13
150 0.13
151 0.13
152 0.15
153 0.19
154 0.22
155 0.3
156 0.36
157 0.38
158 0.39
159 0.39
160 0.38
161 0.34
162 0.32
163 0.26
164 0.22
165 0.18
166 0.18
167 0.21
168 0.21
169 0.22
170 0.23
171 0.23
172 0.23
173 0.26
174 0.29
175 0.28
176 0.29
177 0.28
178 0.27
179 0.27
180 0.28
181 0.27
182 0.27
183 0.28
184 0.3
185 0.35
186 0.39
187 0.43
188 0.51
189 0.53
190 0.57
191 0.58
192 0.56
193 0.51
194 0.46
195 0.38
196 0.34
197 0.3
198 0.25
199 0.22
200 0.21
201 0.2
202 0.18
203 0.17
204 0.1
205 0.09
206 0.06
207 0.05
208 0.05
209 0.05
210 0.05
211 0.05
212 0.05
213 0.05
214 0.06
215 0.05
216 0.05
217 0.04
218 0.04
219 0.04
220 0.03
221 0.03
222 0.02
223 0.02
224 0.02
225 0.02
226 0.02
227 0.03
228 0.03
229 0.04
230 0.05
231 0.05
232 0.06
233 0.07
234 0.08
235 0.08
236 0.09
237 0.11
238 0.1
239 0.1
240 0.11
241 0.1
242 0.1
243 0.1
244 0.09
245 0.07
246 0.06
247 0.07
248 0.06
249 0.07
250 0.08
251 0.09
252 0.08
253 0.1
254 0.12
255 0.11
256 0.15
257 0.16
258 0.14
259 0.14
260 0.14
261 0.12
262 0.12
263 0.12
264 0.1
265 0.1
266 0.11
267 0.13
268 0.15
269 0.16
270 0.15
271 0.16
272 0.16
273 0.15
274 0.14
275 0.12
276 0.11
277 0.1
278 0.13
279 0.11
280 0.1
281 0.11
282 0.11
283 0.1
284 0.1
285 0.1
286 0.08
287 0.09
288 0.09
289 0.1
290 0.1
291 0.1
292 0.1
293 0.15
294 0.17
295 0.17
296 0.18
297 0.18
298 0.2
299 0.22
300 0.23
301 0.22
302 0.19
303 0.18
304 0.16
305 0.15
306 0.13
307 0.12
308 0.09
309 0.06
310 0.05
311 0.05
312 0.05
313 0.05
314 0.04
315 0.04
316 0.04
317 0.03
318 0.05
319 0.05
320 0.05
321 0.05
322 0.05
323 0.07
324 0.11
325 0.12
326 0.11
327 0.12
328 0.13
329 0.17
330 0.17
331 0.16
332 0.14
333 0.14
334 0.14
335 0.14
336 0.14
337 0.1
338 0.11
339 0.12
340 0.12
341 0.14
342 0.13
343 0.13
344 0.15
345 0.2
346 0.22
347 0.23
348 0.2
349 0.19
350 0.21
351 0.21
352 0.24
353 0.2
354 0.25
355 0.3
356 0.32
357 0.36
358 0.37
359 0.43
360 0.44
361 0.49
362 0.45
363 0.45
364 0.46
365 0.43
366 0.41
367 0.35
368 0.28
369 0.23
370 0.19
371 0.12
372 0.09
373 0.08
374 0.07
375 0.08
376 0.1
377 0.1
378 0.13
379 0.13
380 0.16
381 0.17
382 0.19
383 0.2
384 0.19
385 0.19
386 0.16
387 0.16
388 0.13
389 0.12
390 0.1
391 0.08
392 0.08
393 0.07
394 0.07
395 0.08
396 0.14
397 0.18
398 0.22
399 0.24
400 0.28
401 0.31
402 0.34
403 0.41
404 0.36
405 0.32
406 0.31
407 0.35
408 0.36
409 0.38
410 0.43
411 0.39
412 0.43
413 0.43
414 0.43
415 0.45
416 0.43
417 0.44
418 0.4
419 0.39
420 0.35
421 0.36
422 0.39
423 0.34
424 0.3
425 0.26
426 0.27
427 0.26
428 0.24
429 0.23
430 0.17
431 0.16
432 0.17
433 0.17
434 0.17
435 0.21
436 0.23
437 0.26
438 0.31
439 0.33
440 0.32
441 0.36
442 0.34
443 0.3
444 0.34
445 0.4
446 0.46
447 0.49
448 0.51
449 0.47
450 0.49
451 0.46
452 0.43
453 0.43
454 0.34
455 0.33
456 0.35
457 0.36
458 0.32
459 0.32
460 0.3
461 0.21
462 0.2
463 0.18