Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B0DKV8

Protein Details
Accession B0DKV8    Localization Confidence High Confidence Score 23.4
NoLS Segment(s)
PositionSequenceProtein Nature
40-74AEILVKERKREENRERDRKLKERAERNRGKQKEKSBasic
186-210DIDSKTQLPSRKRKRNNAPPKDLVIHydrophilic
221-242ANKPSTPSARPSRKIRKFLDRTHydrophilic
NLS Segment(s)
PositionSequence
39-74KAEILVKERKREENRERDRKLKERAERNRGKQKEKS
195-207SRKRKRNNAPPKD
213-216RAIR
219-258PEANKPSTPSARPSRKIRKFLDRTLALKGGNPKARGWERR
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
KEGG lbc:LACBIDRAFT_330307  -  
Amino Acid Sequences MAMAPRHKESGSSDEEAPETISLTQSKQSVHRRETELKKAEILVKERKREENRERDRKLKERAERNRGKQKEKSGSSRDLDLEARMQRAMQEAQDEMGEEESGDEEEFEGFGGLEGSDDDESGEELSSQEEESGSDNDESDMESNLNDSDRDEQPGRISNPDHLPDELFEAAFKASTTSSKRKVEDIDSKTQLPSRKRKRNNAPPKDLVIGSRAIRVLPEANKPSTPSARPSRKIRKFLDRTLALKGGNPKARGWERRPVNIGVMRRNGGPAANFSLSFEMMSNLSNGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.31
4 0.27
5 0.2
6 0.15
7 0.12
8 0.13
9 0.13
10 0.14
11 0.17
12 0.18
13 0.21
14 0.28
15 0.38
16 0.44
17 0.48
18 0.53
19 0.57
20 0.65
21 0.71
22 0.72
23 0.69
24 0.62
25 0.59
26 0.55
27 0.53
28 0.49
29 0.47
30 0.47
31 0.48
32 0.55
33 0.57
34 0.64
35 0.66
36 0.71
37 0.75
38 0.75
39 0.79
40 0.82
41 0.83
42 0.81
43 0.83
44 0.81
45 0.8
46 0.79
47 0.77
48 0.77
49 0.82
50 0.84
51 0.85
52 0.86
53 0.87
54 0.85
55 0.84
56 0.8
57 0.79
58 0.79
59 0.76
60 0.75
61 0.71
62 0.71
63 0.64
64 0.61
65 0.51
66 0.44
67 0.38
68 0.3
69 0.28
70 0.23
71 0.22
72 0.18
73 0.17
74 0.15
75 0.17
76 0.17
77 0.13
78 0.13
79 0.12
80 0.12
81 0.12
82 0.12
83 0.09
84 0.08
85 0.07
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.03
98 0.03
99 0.04
100 0.03
101 0.03
102 0.03
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05
109 0.05
110 0.05
111 0.04
112 0.04
113 0.04
114 0.05
115 0.05
116 0.04
117 0.04
118 0.05
119 0.06
120 0.07
121 0.08
122 0.07
123 0.08
124 0.08
125 0.08
126 0.08
127 0.06
128 0.06
129 0.05
130 0.05
131 0.05
132 0.05
133 0.06
134 0.05
135 0.05
136 0.09
137 0.09
138 0.13
139 0.14
140 0.14
141 0.15
142 0.21
143 0.21
144 0.2
145 0.2
146 0.2
147 0.23
148 0.25
149 0.25
150 0.2
151 0.19
152 0.17
153 0.19
154 0.15
155 0.11
156 0.09
157 0.08
158 0.07
159 0.07
160 0.07
161 0.05
162 0.05
163 0.1
164 0.16
165 0.22
166 0.29
167 0.34
168 0.36
169 0.38
170 0.41
171 0.44
172 0.48
173 0.47
174 0.48
175 0.46
176 0.46
177 0.44
178 0.44
179 0.43
180 0.41
181 0.46
182 0.49
183 0.57
184 0.65
185 0.75
186 0.83
187 0.88
188 0.91
189 0.91
190 0.89
191 0.83
192 0.78
193 0.7
194 0.59
195 0.49
196 0.4
197 0.33
198 0.25
199 0.22
200 0.19
201 0.15
202 0.15
203 0.16
204 0.18
205 0.18
206 0.25
207 0.26
208 0.29
209 0.3
210 0.32
211 0.36
212 0.36
213 0.36
214 0.36
215 0.42
216 0.5
217 0.56
218 0.64
219 0.7
220 0.74
221 0.81
222 0.8
223 0.81
224 0.79
225 0.8
226 0.79
227 0.74
228 0.67
229 0.64
230 0.6
231 0.49
232 0.45
233 0.45
234 0.44
235 0.43
236 0.43
237 0.38
238 0.44
239 0.53
240 0.58
241 0.55
242 0.57
243 0.57
244 0.63
245 0.67
246 0.6
247 0.59
248 0.56
249 0.56
250 0.54
251 0.53
252 0.47
253 0.43
254 0.42
255 0.35
256 0.32
257 0.27
258 0.24
259 0.25
260 0.25
261 0.24
262 0.24
263 0.25
264 0.23
265 0.22
266 0.18
267 0.13
268 0.12
269 0.13