Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3AS57

Protein Details
Accession M3AS57    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-42LGIVHRTSCYGRRKNKQKDFRNHHRRHAFQAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9.5, mito 9, cyto_nucl 8, cyto 5.5
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_177264  -  
Amino Acid Sequences MIPNFRGEGGRLGIVHRTSCYGRRKNKQKDFRNHHRRHAFQAMCIMSADNLHRMKRCVDPQMCCFPGGWTARSDEITTCPKQLKKLSNQNFKDSGQSRGEELQQLRKLSSRSLSNWTSSGSTGPVSKIAARLDEKRGVSVACDSDAKQYSMPGSANARTVDAAELWFCQAEDPYTYIGGKPDQSAAHVNLRLIFIDTASNRALLLSSCSWLADDVSLGKVNWSCCRDAALRIMFCSAVRYKVHLNYIVPAAVVDAHRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.21
4 0.23
5 0.24
6 0.31
7 0.4
8 0.45
9 0.53
10 0.63
11 0.73
12 0.8
13 0.88
14 0.91
15 0.91
16 0.93
17 0.93
18 0.93
19 0.94
20 0.9
21 0.9
22 0.89
23 0.82
24 0.79
25 0.79
26 0.69
27 0.6
28 0.61
29 0.51
30 0.41
31 0.37
32 0.29
33 0.19
34 0.2
35 0.19
36 0.17
37 0.2
38 0.22
39 0.24
40 0.26
41 0.29
42 0.34
43 0.38
44 0.41
45 0.44
46 0.47
47 0.5
48 0.57
49 0.55
50 0.48
51 0.43
52 0.33
53 0.34
54 0.32
55 0.27
56 0.19
57 0.2
58 0.22
59 0.22
60 0.22
61 0.16
62 0.18
63 0.23
64 0.23
65 0.23
66 0.27
67 0.27
68 0.32
69 0.39
70 0.43
71 0.47
72 0.57
73 0.64
74 0.7
75 0.71
76 0.71
77 0.67
78 0.59
79 0.58
80 0.48
81 0.44
82 0.36
83 0.33
84 0.29
85 0.27
86 0.28
87 0.24
88 0.24
89 0.27
90 0.27
91 0.27
92 0.26
93 0.27
94 0.27
95 0.24
96 0.26
97 0.22
98 0.21
99 0.27
100 0.28
101 0.26
102 0.26
103 0.25
104 0.22
105 0.19
106 0.16
107 0.11
108 0.1
109 0.09
110 0.09
111 0.09
112 0.08
113 0.09
114 0.1
115 0.1
116 0.12
117 0.14
118 0.17
119 0.2
120 0.24
121 0.23
122 0.21
123 0.22
124 0.18
125 0.17
126 0.16
127 0.13
128 0.09
129 0.1
130 0.1
131 0.14
132 0.15
133 0.16
134 0.14
135 0.14
136 0.13
137 0.14
138 0.14
139 0.12
140 0.13
141 0.13
142 0.16
143 0.15
144 0.15
145 0.13
146 0.13
147 0.12
148 0.09
149 0.09
150 0.07
151 0.07
152 0.06
153 0.06
154 0.06
155 0.06
156 0.06
157 0.06
158 0.07
159 0.08
160 0.08
161 0.09
162 0.1
163 0.1
164 0.11
165 0.12
166 0.12
167 0.11
168 0.13
169 0.13
170 0.15
171 0.18
172 0.19
173 0.23
174 0.24
175 0.23
176 0.22
177 0.23
178 0.21
179 0.19
180 0.16
181 0.1
182 0.14
183 0.13
184 0.15
185 0.14
186 0.14
187 0.12
188 0.12
189 0.12
190 0.08
191 0.13
192 0.11
193 0.11
194 0.11
195 0.12
196 0.12
197 0.12
198 0.12
199 0.08
200 0.07
201 0.08
202 0.1
203 0.11
204 0.11
205 0.13
206 0.15
207 0.17
208 0.23
209 0.25
210 0.24
211 0.23
212 0.29
213 0.28
214 0.29
215 0.35
216 0.35
217 0.33
218 0.33
219 0.34
220 0.3
221 0.28
222 0.3
223 0.23
224 0.22
225 0.22
226 0.25
227 0.3
228 0.35
229 0.4
230 0.4
231 0.39
232 0.37
233 0.38
234 0.34
235 0.29
236 0.23
237 0.18
238 0.16