Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1QD17

Protein Details
Accession N1QD17    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
273-292FPWSDKGREKRGKVNNDEARHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR000791  Gpr1/Fun34/SatP  
Gene Ontology GO:0016020  C:membrane  
KEGG pfj:MYCFIDRAFT_50227  -  
Pfam View protein in Pfam  
PF01184  Gpr1_Fun34_YaaH  
PROSITE View protein in PROSITE  
PS01114  GPR1_FUN34_YAAH  
Amino Acid Sequences MSSAQGQNDEKPTNGVQPGDFNGVGAHDHAGGVATQRKPYDYGGNPLAHVNTGDSARLAAFGGELQPGLYKVDTNRKIANPAPLGLCGFALTTFLLSLINLGTCGLSEPNLVIGAAFAYGGLVQLLAGMWEMAIGNTFGATALSSYGGFWIGTAIILTPGGFEIIKTLEADTPYPFLNSFGLYLMGWFIFTFLLLILTLRSTVAFFFLFLTLDLAFLMLGIGYLVNDGGKPNTSCIRAGGAFGIIAAFAAWYNALAGMADSSNSFFVVPVAHFPWSDKGREKRGKVNNDEARAAQQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.25
4 0.27
5 0.3
6 0.31
7 0.29
8 0.22
9 0.2
10 0.19
11 0.18
12 0.15
13 0.13
14 0.08
15 0.08
16 0.08
17 0.08
18 0.07
19 0.1
20 0.16
21 0.17
22 0.2
23 0.21
24 0.23
25 0.25
26 0.27
27 0.33
28 0.3
29 0.35
30 0.38
31 0.38
32 0.37
33 0.37
34 0.34
35 0.25
36 0.22
37 0.16
38 0.13
39 0.12
40 0.12
41 0.1
42 0.1
43 0.09
44 0.1
45 0.08
46 0.06
47 0.06
48 0.06
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06
54 0.07
55 0.08
56 0.08
57 0.08
58 0.12
59 0.23
60 0.26
61 0.3
62 0.34
63 0.34
64 0.39
65 0.4
66 0.44
67 0.36
68 0.34
69 0.31
70 0.27
71 0.26
72 0.22
73 0.19
74 0.11
75 0.09
76 0.07
77 0.07
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.04
84 0.05
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.06
98 0.05
99 0.04
100 0.04
101 0.04
102 0.04
103 0.03
104 0.03
105 0.02
106 0.03
107 0.03
108 0.03
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.02
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.04
151 0.05
152 0.05
153 0.06
154 0.06
155 0.07
156 0.08
157 0.09
158 0.09
159 0.1
160 0.1
161 0.1
162 0.09
163 0.09
164 0.09
165 0.08
166 0.08
167 0.07
168 0.08
169 0.07
170 0.07
171 0.06
172 0.06
173 0.05
174 0.05
175 0.05
176 0.04
177 0.04
178 0.04
179 0.03
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.05
188 0.04
189 0.05
190 0.06
191 0.06
192 0.06
193 0.07
194 0.08
195 0.08
196 0.08
197 0.09
198 0.07
199 0.07
200 0.07
201 0.06
202 0.05
203 0.04
204 0.04
205 0.03
206 0.02
207 0.02
208 0.02
209 0.02
210 0.03
211 0.03
212 0.03
213 0.03
214 0.04
215 0.06
216 0.09
217 0.09
218 0.13
219 0.17
220 0.19
221 0.19
222 0.2
223 0.23
224 0.21
225 0.21
226 0.19
227 0.14
228 0.12
229 0.12
230 0.1
231 0.06
232 0.05
233 0.04
234 0.03
235 0.03
236 0.03
237 0.03
238 0.03
239 0.04
240 0.04
241 0.04
242 0.04
243 0.04
244 0.05
245 0.05
246 0.06
247 0.06
248 0.07
249 0.07
250 0.08
251 0.08
252 0.07
253 0.07
254 0.09
255 0.09
256 0.12
257 0.14
258 0.16
259 0.16
260 0.18
261 0.26
262 0.27
263 0.32
264 0.37
265 0.43
266 0.52
267 0.62
268 0.65
269 0.67
270 0.74
271 0.79
272 0.78
273 0.8
274 0.78
275 0.74
276 0.72
277 0.63