Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2ZM41

Protein Details
Accession M2ZM41   
Localization Confidence High
Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-36GDEYRPPVPRYRKTTRYPRRYSPSPPPVRRIHydrophilic
NLS Segment(s)
PositionSequence
34-35RR
42-45RRAP
67-175PSKAPSAAPPPTAPPSKPPSAAPSKPPTAAPDPPPEPSAPGSKAPSKAPTAPPSKAPTAAPSKAPSKAPSAAPDPPPSKAPSKAPTAAPSKAPSAAGSKAPTEKPPSKA
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_211976  -  
Amino Acid Sequences MCFGLGDEYRPPVPRYRKTTRYPRRYSPSPPPVRRIERTYIRRAPSPLPPPPPAASIPPPPPSVWPPSKAPSAAPPPTAPPSKPPSAAPSKPPTAAPDPPPEPSAPGSKAPSKAPTAPPSKAPTAAPSKAPSKAPSAAPDPPPSKAPSKAPTAAPSKAPSAAGSKAPTEKPPSKAPSAAGSKALTKANYIEVNEEEPASGGSSSSDARSQSTRRTSVSSRRTSAPPASEYSMHEKEREIRRYSKPPPRSDWETFRYVDAPAPPPVREFSRARSVGRRRDDYGPRDSWERDIKISINRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.56
3 0.62
4 0.68
5 0.75
6 0.84
7 0.85
8 0.87
9 0.86
10 0.87
11 0.86
12 0.84
13 0.83
14 0.82
15 0.82
16 0.82
17 0.8
18 0.77
19 0.78
20 0.79
21 0.77
22 0.72
23 0.71
24 0.7
25 0.71
26 0.74
27 0.73
28 0.68
29 0.67
30 0.65
31 0.59
32 0.58
33 0.59
34 0.57
35 0.55
36 0.54
37 0.53
38 0.51
39 0.5
40 0.42
41 0.4
42 0.37
43 0.37
44 0.39
45 0.39
46 0.38
47 0.36
48 0.38
49 0.36
50 0.4
51 0.37
52 0.36
53 0.37
54 0.4
55 0.43
56 0.4
57 0.37
58 0.36
59 0.4
60 0.39
61 0.36
62 0.33
63 0.33
64 0.38
65 0.4
66 0.33
67 0.31
68 0.35
69 0.36
70 0.37
71 0.34
72 0.36
73 0.42
74 0.44
75 0.45
76 0.45
77 0.44
78 0.44
79 0.43
80 0.4
81 0.37
82 0.39
83 0.36
84 0.37
85 0.36
86 0.36
87 0.37
88 0.32
89 0.29
90 0.26
91 0.26
92 0.21
93 0.22
94 0.24
95 0.26
96 0.29
97 0.29
98 0.3
99 0.29
100 0.32
101 0.34
102 0.38
103 0.39
104 0.38
105 0.4
106 0.41
107 0.39
108 0.36
109 0.31
110 0.29
111 0.3
112 0.3
113 0.28
114 0.27
115 0.28
116 0.29
117 0.3
118 0.27
119 0.24
120 0.26
121 0.25
122 0.25
123 0.26
124 0.28
125 0.29
126 0.33
127 0.3
128 0.28
129 0.28
130 0.28
131 0.27
132 0.25
133 0.27
134 0.25
135 0.29
136 0.3
137 0.3
138 0.32
139 0.34
140 0.33
141 0.3
142 0.28
143 0.25
144 0.23
145 0.22
146 0.17
147 0.16
148 0.16
149 0.16
150 0.15
151 0.15
152 0.18
153 0.19
154 0.2
155 0.25
156 0.28
157 0.3
158 0.36
159 0.38
160 0.37
161 0.38
162 0.37
163 0.37
164 0.37
165 0.34
166 0.29
167 0.26
168 0.25
169 0.26
170 0.27
171 0.2
172 0.16
173 0.16
174 0.17
175 0.19
176 0.18
177 0.17
178 0.16
179 0.17
180 0.17
181 0.16
182 0.12
183 0.09
184 0.09
185 0.08
186 0.07
187 0.05
188 0.05
189 0.06
190 0.07
191 0.08
192 0.1
193 0.09
194 0.11
195 0.16
196 0.18
197 0.25
198 0.31
199 0.33
200 0.33
201 0.38
202 0.41
203 0.47
204 0.55
205 0.54
206 0.51
207 0.52
208 0.53
209 0.53
210 0.52
211 0.47
212 0.39
213 0.36
214 0.36
215 0.33
216 0.34
217 0.37
218 0.38
219 0.34
220 0.32
221 0.31
222 0.36
223 0.44
224 0.49
225 0.46
226 0.47
227 0.54
228 0.63
229 0.71
230 0.73
231 0.73
232 0.73
233 0.75
234 0.76
235 0.76
236 0.73
237 0.72
238 0.67
239 0.63
240 0.56
241 0.51
242 0.44
243 0.36
244 0.32
245 0.28
246 0.27
247 0.28
248 0.3
249 0.28
250 0.29
251 0.32
252 0.32
253 0.34
254 0.34
255 0.34
256 0.42
257 0.45
258 0.47
259 0.54
260 0.59
261 0.63
262 0.68
263 0.68
264 0.62
265 0.68
266 0.73
267 0.69
268 0.68
269 0.62
270 0.57
271 0.57
272 0.54
273 0.52
274 0.51
275 0.48
276 0.43
277 0.43
278 0.43