Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

N1Q9H9

Protein Details
Accession N1Q9H9    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
89-108KISKRRKNTEAARRYRQRKVBasic
NLS Segment(s)
PositionSequence
92-103KRRKNTEAARRY
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
KEGG pfj:MYCFIDRAFT_181576  -  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd12193  bZIP_GCN4  
Amino Acid Sequences MDGSGDFYDPYTTTSTALSATNPRPPSSSDPSTQQSPNDDDDFILFPSPPHNHTTSSSSCDHSPPNAKSSSNPHLSPSSSSNTGASSNKISKRRKNTEAARRYRQRKVDRVTELEEALAAVQKERDELKFRLVRCEAEVEVLRRVGMGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.14
5 0.14
6 0.18
7 0.21
8 0.28
9 0.29
10 0.3
11 0.3
12 0.34
13 0.39
14 0.4
15 0.42
16 0.37
17 0.41
18 0.44
19 0.47
20 0.45
21 0.39
22 0.35
23 0.33
24 0.34
25 0.3
26 0.26
27 0.21
28 0.21
29 0.2
30 0.17
31 0.14
32 0.1
33 0.08
34 0.13
35 0.14
36 0.15
37 0.17
38 0.18
39 0.2
40 0.23
41 0.28
42 0.25
43 0.28
44 0.28
45 0.26
46 0.25
47 0.25
48 0.24
49 0.23
50 0.28
51 0.25
52 0.26
53 0.26
54 0.26
55 0.26
56 0.32
57 0.34
58 0.31
59 0.3
60 0.29
61 0.28
62 0.29
63 0.29
64 0.24
65 0.21
66 0.18
67 0.18
68 0.17
69 0.16
70 0.18
71 0.16
72 0.15
73 0.16
74 0.2
75 0.26
76 0.34
77 0.41
78 0.46
79 0.56
80 0.63
81 0.65
82 0.69
83 0.73
84 0.75
85 0.78
86 0.79
87 0.79
88 0.8
89 0.8
90 0.79
91 0.78
92 0.76
93 0.75
94 0.74
95 0.73
96 0.69
97 0.67
98 0.64
99 0.56
100 0.48
101 0.38
102 0.31
103 0.22
104 0.16
105 0.13
106 0.09
107 0.07
108 0.08
109 0.08
110 0.11
111 0.13
112 0.17
113 0.21
114 0.22
115 0.31
116 0.35
117 0.35
118 0.43
119 0.43
120 0.41
121 0.38
122 0.41
123 0.32
124 0.33
125 0.37
126 0.3
127 0.31
128 0.29
129 0.26