Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DG44

Protein Details
Accession B0DG44   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPAKAKKSPTKAARKGRRATKTSKHydrophilic
NLS Segment(s)
PositionSequence
4-21KAKKSPTKAARKGRRATK
Subcellular Location(s) mito 11.5, mito_nucl 9, cyto 8, nucl 5.5
Family & Domain DBs
KEGG lbc:LACBIDRAFT_328830  -  
Amino Acid Sequences MPAKAKKSPTKAARKGRRATKTSKGDEATASADVVEVVDSKDVVDDKTATKINWSDQTLSQSLITAITDDPDIKQGLFPPPGPNASSAKGGGKKKTLWQWKVAVAIFKEHPTPKAEAKTSVVVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.88
4 0.87
5 0.82
6 0.79
7 0.79
8 0.78
9 0.73
10 0.71
11 0.63
12 0.55
13 0.5
14 0.44
15 0.36
16 0.27
17 0.21
18 0.14
19 0.11
20 0.09
21 0.08
22 0.06
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.06
29 0.06
30 0.06
31 0.07
32 0.08
33 0.09
34 0.13
35 0.14
36 0.13
37 0.15
38 0.16
39 0.18
40 0.22
41 0.23
42 0.21
43 0.21
44 0.25
45 0.23
46 0.22
47 0.19
48 0.14
49 0.12
50 0.1
51 0.09
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.07
59 0.08
60 0.07
61 0.07
62 0.09
63 0.13
64 0.15
65 0.15
66 0.17
67 0.18
68 0.2
69 0.2
70 0.21
71 0.2
72 0.2
73 0.21
74 0.19
75 0.22
76 0.28
77 0.31
78 0.33
79 0.34
80 0.35
81 0.4
82 0.48
83 0.54
84 0.5
85 0.52
86 0.53
87 0.52
88 0.55
89 0.5
90 0.46
91 0.36
92 0.37
93 0.33
94 0.31
95 0.33
96 0.29
97 0.3
98 0.29
99 0.33
100 0.35
101 0.41
102 0.41
103 0.4
104 0.42