Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2ZSH7

Protein Details
Accession M2ZSH7   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-28LHLFHHRNKNQHRRSHWYKHMNTFRRQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 4, plas 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR047205  RMP1  
IPR047204  RMP1_RBD  
Gene Ontology GO:0000172  C:ribonuclease MRP complex  
GO:0042134  F:rRNA primary transcript binding  
KEGG pfj:MYCFIDRAFT_18376  -  
CDD cd22573  RMP1_RBD  
Amino Acid Sequences LLHLFHHRNKNQHRRSHWYKHMNTFRRQLQSLLSDLKTLNSVPSTHTSARLEFWREVMVSKWQFAFSQVVADGRFSVLGVFLYSCLAEVGKLVGMTGMLEEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.85
4 0.84
5 0.83
6 0.81
7 0.82
8 0.85
9 0.82
10 0.79
11 0.76
12 0.73
13 0.69
14 0.63
15 0.53
16 0.46
17 0.41
18 0.38
19 0.34
20 0.27
21 0.22
22 0.21
23 0.2
24 0.17
25 0.15
26 0.13
27 0.1
28 0.1
29 0.1
30 0.14
31 0.18
32 0.17
33 0.21
34 0.21
35 0.2
36 0.22
37 0.22
38 0.22
39 0.17
40 0.17
41 0.15
42 0.14
43 0.14
44 0.14
45 0.19
46 0.16
47 0.17
48 0.17
49 0.17
50 0.17
51 0.18
52 0.19
53 0.11
54 0.12
55 0.12
56 0.12
57 0.12
58 0.12
59 0.1
60 0.09
61 0.08
62 0.07
63 0.06
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.05
75 0.05
76 0.06
77 0.07
78 0.07
79 0.07
80 0.06
81 0.06
82 0.07