Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M3AME9

Protein Details
Accession M3AME9   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
38-58RPKAGPPERKRQRSEARSRASBasic
NLS Segment(s)
PositionSequence
30-55GPERTGPGRPKAGPPERKRQRSEARS
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
KEGG pfj:MYCFIDRAFT_80713  -  
Amino Acid Sequences MSKRGVNELFMIDDDEGEDPRNSEPPPRDGPERTGPGRPKAGPPERKRQRSEARSRASTAGATPVVEDLTDDNIMFIEIPGEKLLRLKKEELLDFIKNKGTEIFCEAYEKCLNEKLKTALKDRPDTLRLGNKVKIINRYETVWKKELSTARNLIAKEMDDLEAILPSLHWPSQRAQFQRDFIGPVEQRLARAEKGVKTFAALIRKLQDTSNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.11
4 0.12
5 0.12
6 0.11
7 0.12
8 0.16
9 0.16
10 0.22
11 0.26
12 0.3
13 0.37
14 0.41
15 0.45
16 0.45
17 0.51
18 0.52
19 0.55
20 0.52
21 0.53
22 0.53
23 0.53
24 0.56
25 0.52
26 0.5
27 0.53
28 0.6
29 0.62
30 0.64
31 0.69
32 0.73
33 0.8
34 0.78
35 0.78
36 0.78
37 0.79
38 0.83
39 0.82
40 0.79
41 0.74
42 0.72
43 0.64
44 0.54
45 0.44
46 0.33
47 0.27
48 0.2
49 0.16
50 0.13
51 0.12
52 0.1
53 0.09
54 0.09
55 0.06
56 0.07
57 0.08
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.06
64 0.05
65 0.04
66 0.05
67 0.06
68 0.06
69 0.06
70 0.1
71 0.13
72 0.16
73 0.18
74 0.2
75 0.23
76 0.27
77 0.28
78 0.28
79 0.29
80 0.29
81 0.27
82 0.27
83 0.26
84 0.22
85 0.21
86 0.2
87 0.16
88 0.13
89 0.16
90 0.16
91 0.13
92 0.16
93 0.16
94 0.16
95 0.17
96 0.17
97 0.14
98 0.19
99 0.2
100 0.18
101 0.21
102 0.22
103 0.26
104 0.28
105 0.31
106 0.3
107 0.34
108 0.37
109 0.36
110 0.38
111 0.34
112 0.33
113 0.33
114 0.35
115 0.34
116 0.34
117 0.35
118 0.33
119 0.36
120 0.37
121 0.4
122 0.36
123 0.36
124 0.33
125 0.34
126 0.39
127 0.41
128 0.43
129 0.39
130 0.36
131 0.34
132 0.38
133 0.41
134 0.35
135 0.36
136 0.33
137 0.34
138 0.37
139 0.35
140 0.31
141 0.27
142 0.24
143 0.19
144 0.18
145 0.15
146 0.11
147 0.11
148 0.1
149 0.09
150 0.08
151 0.06
152 0.05
153 0.05
154 0.08
155 0.09
156 0.1
157 0.12
158 0.15
159 0.24
160 0.32
161 0.35
162 0.39
163 0.43
164 0.45
165 0.48
166 0.46
167 0.39
168 0.33
169 0.38
170 0.32
171 0.29
172 0.32
173 0.28
174 0.27
175 0.29
176 0.31
177 0.23
178 0.28
179 0.31
180 0.31
181 0.35
182 0.37
183 0.33
184 0.31
185 0.35
186 0.33
187 0.36
188 0.32
189 0.32
190 0.34
191 0.37
192 0.36